NACA_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NACA_CAEEL
• UniProt AC: Q86S66
• Protein Name: Nascent polypeptide-associated complex subunit alpha
• Gene Name: icd-2 {ECO:0000312|WormBase:Y65B4BR.5a}
• Organism: Caenorhabditis elegans.
• Sequence Length: 197
• Protein Description: May promote appropriate targeting of ribosome-nascent polypeptide complexes..
• Protein Sequence: MTGSTETRQKEVKEPQVDVSDDSDNEAVEQELTEEQRRVAEAAGLGDHIDKQAKQSRSEKKARKLFSKLGLKQVTGVSRVCIRKSKNILFVINKPDVFKSPGSDTYIIFGEAKIEDLTQHAQMSAIENLKPTREAPQLKTVEEDENEDVEFKEDSTGIEEKDIELVISQANTTRNKAIRALKEADNDIVNAIMSLTM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MTGSTETRQKE ----CCCCHHHHCHH	17.57	30078680
20	Phosphorylation	KEPQVDVSDDSDNEA CCCCCCCCCCCCCHH	31.10	28854356
23	Phosphorylation	QVDVSDDSDNEAVEQ CCCCCCCCCCHHHHH	47.53	28854356
100	Phosphorylation	NKPDVFKSPGSDTYI ECCCCCCCCCCCCEE	24.03	30078680
103	Phosphorylation	DVFKSPGSDTYIIFG CCCCCCCCCCEEEEE	30.11	30078680
105	Phosphorylation	FKSPGSDTYIIFGEA CCCCCCCCEEEEEEE	20.51	30078680
155	Phosphorylation	DVEFKEDSTGIEEKD CCCCCCCCCCCCHHH	29.62	30078680
156	Phosphorylation	VEFKEDSTGIEEKDI CCCCCCCCCCCHHHH	55.27	30078680
168	Phosphorylation	KDIELVISQANTTRN HHHEEEEEECHHHHH	18.76	30078680
172	Phosphorylation	LVISQANTTRNKAIR EEEEECHHHHHHHHH	30.10	30078680
173	Phosphorylation	VISQANTTRNKAIRA EEEECHHHHHHHHHH	31.86	30078680

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NACA_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NACA_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NACA_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YWZ3_CAEEL	C02B8.3	physical	14704431
BTF3_CAEEL	icd-1	physical	14704431
NACA_CAEEL	Y65B4BR.5	physical	14704431

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.