UniProt ID | NACA_CAEEL | |
---|---|---|
UniProt AC | Q86S66 | |
Protein Name | Nascent polypeptide-associated complex subunit alpha | |
Gene Name | icd-2 {ECO:0000312|WormBase:Y65B4BR.5a} | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 197 | |
Subcellular Localization | ||
Protein Description | May promote appropriate targeting of ribosome-nascent polypeptide complexes.. | |
Protein Sequence | MTGSTETRQKEVKEPQVDVSDDSDNEAVEQELTEEQRRVAEAAGLGDHIDKQAKQSRSEKKARKLFSKLGLKQVTGVSRVCIRKSKNILFVINKPDVFKSPGSDTYIIFGEAKIEDLTQHAQMSAIENLKPTREAPQLKTVEEDENEDVEFKEDSTGIEEKDIELVISQANTTRNKAIRALKEADNDIVNAIMSLTM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MTGSTETRQKE ----CCCCHHHHCHH | 17.57 | 30078680 | |
20 | Phosphorylation | KEPQVDVSDDSDNEA CCCCCCCCCCCCCHH | 31.10 | 28854356 | |
23 | Phosphorylation | QVDVSDDSDNEAVEQ CCCCCCCCCCHHHHH | 47.53 | 28854356 | |
100 | Phosphorylation | NKPDVFKSPGSDTYI ECCCCCCCCCCCCEE | 24.03 | 30078680 | |
103 | Phosphorylation | DVFKSPGSDTYIIFG CCCCCCCCCCEEEEE | 30.11 | 30078680 | |
105 | Phosphorylation | FKSPGSDTYIIFGEA CCCCCCCCEEEEEEE | 20.51 | 30078680 | |
155 | Phosphorylation | DVEFKEDSTGIEEKD CCCCCCCCCCCCHHH | 29.62 | 30078680 | |
156 | Phosphorylation | VEFKEDSTGIEEKDI CCCCCCCCCCCHHHH | 55.27 | 30078680 | |
168 | Phosphorylation | KDIELVISQANTTRN HHHEEEEEECHHHHH | 18.76 | 30078680 | |
172 | Phosphorylation | LVISQANTTRNKAIR EEEEECHHHHHHHHH | 30.10 | 30078680 | |
173 | Phosphorylation | VISQANTTRNKAIRA EEEECHHHHHHHHHH | 31.86 | 30078680 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NACA_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NACA_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NACA_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YWZ3_CAEEL | C02B8.3 | physical | 14704431 | |
BTF3_CAEEL | icd-1 | physical | 14704431 | |
NACA_CAEEL | Y65B4BR.5 | physical | 14704431 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...