UniProt ID | SMA6_CAEEL | |
---|---|---|
UniProt AC | Q09488 | |
Protein Name | Serine/threonine-protein kinase sma-6 | |
Gene Name | sma-6 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 636 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
Protein Description | Involved in TGF-beta pathway. May be a receptor for daf-7.. | |
Protein Sequence | MNITFIFILIFGFFNTQKCSKDYDHFDDEDLALSIPKNAIGVPKEFRQQVLKEMKLRNRPNDILKNRCYCNYDQSICGNNMTCVKQDGAACYHAVEEVYNKAEKRMETLHKWGCATLERGSGASHLTCNSWRAAHHSPKSIGCCYEGNYCNKNLIPPAYVHHHKEKALQEKTDNPEDYDSPLENMTRGGKMFIMVFATVMSVFAVIGCIYLCITRAEEKSKARARAKTVSLKTESTYMESKSMLEDSGSGSGQAALIQRTVRQDLTIIKTIGQGRYGEVRKALYRGSYVAVKTFYTTDEDSWKNERDVYQTNMINHENILQFVAADIWSEEDSMTKMLLITDYHELGSLSDYLCREETLTTDEALRLIHSCICGIEHLHAAVHGTGSFRKPEIAHRDIKSKNIIVKRPNVCCIADLGLALRYQNDKILPEKFNVQVGTKRYMAPELISNKLNPKDFSQFKMADIYSMALVMWEVAIRVEVNTCEEVLTVDETSPDHSASSGIGESVSSSGNISRMHLQKTNVEGHSTSLKAKQHVPPFDGIVHNDPNFDEMNDVICVRRIRPPPDLAWKNVPALNELSKLMEDSWHSIPHFRHSALKLKKEMAELIKNPDRQNQSQRKVEFQQQDSGLVESATNQS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SMA6_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SMA6_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMA6_CAEEL !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...