| UniProt ID | SMA6_CAEEL | |
|---|---|---|
| UniProt AC | Q09488 | |
| Protein Name | Serine/threonine-protein kinase sma-6 | |
| Gene Name | sma-6 | |
| Organism | Caenorhabditis elegans. | |
| Sequence Length | 636 | |
| Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
| Protein Description | Involved in TGF-beta pathway. May be a receptor for daf-7.. | |
| Protein Sequence | MNITFIFILIFGFFNTQKCSKDYDHFDDEDLALSIPKNAIGVPKEFRQQVLKEMKLRNRPNDILKNRCYCNYDQSICGNNMTCVKQDGAACYHAVEEVYNKAEKRMETLHKWGCATLERGSGASHLTCNSWRAAHHSPKSIGCCYEGNYCNKNLIPPAYVHHHKEKALQEKTDNPEDYDSPLENMTRGGKMFIMVFATVMSVFAVIGCIYLCITRAEEKSKARARAKTVSLKTESTYMESKSMLEDSGSGSGQAALIQRTVRQDLTIIKTIGQGRYGEVRKALYRGSYVAVKTFYTTDEDSWKNERDVYQTNMINHENILQFVAADIWSEEDSMTKMLLITDYHELGSLSDYLCREETLTTDEALRLIHSCICGIEHLHAAVHGTGSFRKPEIAHRDIKSKNIIVKRPNVCCIADLGLALRYQNDKILPEKFNVQVGTKRYMAPELISNKLNPKDFSQFKMADIYSMALVMWEVAIRVEVNTCEEVLTVDETSPDHSASSGIGESVSSSGNISRMHLQKTNVEGHSTSLKAKQHVPPFDGIVHNDPNFDEMNDVICVRRIRPPPDLAWKNVPALNELSKLMEDSWHSIPHFRHSALKLKKEMAELIKNPDRQNQSQRKVEFQQQDSGLVESATNQS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SMA6_CAEEL !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SMA6_CAEEL !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMA6_CAEEL !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
