UniProt ID | CAV1_CAEEL | |
---|---|---|
UniProt AC | Q94051 | |
Protein Name | Caveolin-1 | |
Gene Name | cav-1 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 235 | |
Subcellular Localization |
Golgi apparatus membrane Peripheral membrane protein. Cell membrane Peripheral membrane protein. Membrane, caveola Peripheral membrane protein. Potential hairpin-like structure in the membrane. Membrane protein of caveolae (By similarity).. |
|
Protein Description | May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity.. | |
Protein Sequence | MSTEQDIKTEEQIPLTYAAVAAPTVQTEGEAVVAPEEPKPKKNWFTFGKKKAAPTDETNIEEGGAPGDEPVKEKKEKKCWWSRCQKGEGEQKEENIAIGVDLVNRDANSMNNHVQLNFEDIFGEADSQHSWDCVWRLNHTVFTAVRLFIYRLVSLLALPFTIIFAIFFGLLASINVFIIVPLGKLLSIPGTLLAKLWNWLIHAIFDPIASAVGLIFSNFNIRKYGINQETTAPCV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSTEQDIKT ------CCHHHHCCC | 40.42 | 19530675 | |
3 | Phosphorylation | -----MSTEQDIKTE -----CCHHHHCCCH | 36.05 | 19530675 | |
230 | Phosphorylation | KYGINQETTAPCV-- HCCCCCCCCCCCC-- | 20.63 | 30078680 | |
231 | Phosphorylation | YGINQETTAPCV--- CCCCCCCCCCCC--- | 28.05 | 30078680 | |
234 | S-palmitoylation | NQETTAPCV------ CCCCCCCCC------ | 5.42 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CAV1_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CAV1_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAV1_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBIQ1_CAEEL | ubq-1 | physical | 24595290 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...