UBIQ1_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UBIQ1_CAEEL
• UniProt AC: P0CG71
• Protein Name: Polyubiquitin-A
• Gene Name: ubq-1
• Organism: Caenorhabditis elegans.
• Sequence Length: 838
• Subcellular Localization: Ubiquitin: Cytoplasm. Nucleus.
• Protein Description: Ubiquitin exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-48-linked is involved in protein degradation via the proteasome. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling (By similarity)..
• Protein Sequence: MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLIGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGDI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
55	Phosphorylation	KQLEDGRTLSDYNIQ CCCCCCCCCCCCCCC	35.82	30078680
57	Phosphorylation	LEDGRTLSDYNIQKE CCCCCCCCCCCCCCH	37.12	30078680
131	Phosphorylation	KQLEDGRTLSDYNIQ CCCCCCCCCCCCCCC	35.82	30078680
133	Phosphorylation	LEDGRTLSDYNIQKE CCCCCCCCCCCCCCH	37.12	30078680
207	Phosphorylation	KQLEDGRTLSDYNIQ CCCCCCCCCCCCCCC	35.82	30078680
209	Phosphorylation	LEDGRTLSDYNIQKE CCCCCCCCCCCCCCH	37.12	30078680
283	Phosphorylation	KQLEDGRTLSDYNIQ CCCCCCCCCCCCCCC	35.82	30078680
285	Phosphorylation	LEDGRTLSDYNIQKE CCCCCCCCCCCCCCH	37.12	30078680
359	Phosphorylation	KQLEDGRTLSDYNIQ CCCCCCCCCCCCCCC	35.82	30078680
361	Phosphorylation	LEDGRTLSDYNIQKE CCCCCCCCCCCCCCH	37.12	30078680
435	Phosphorylation	KQLEDGRTLSDYNIQ CCCCCCCCCCCCCCC	35.82	30078680
437	Phosphorylation	LEDGRTLSDYNIQKE CCCCCCCCCCCCCCH	37.12	30078680
511	Phosphorylation	KQLEDGRTLSDYNIQ CCCCCCCCCCCCCCC	35.82	30078680
513	Phosphorylation	LEDGRTLSDYNIQKE CCCCCCCCCCCCCCH	37.12	30078680
587	Phosphorylation	KQLEDGRTLSDYNIQ CCCCCCCCCCCCCCC	35.82	30078680
589	Phosphorylation	LEDGRTLSDYNIQKE CCCCCCCCCCCCCCH	37.12	30078680
663	Phosphorylation	KQLEDGRTLSDYNIQ CCCCCCCCCCCCCCC	35.82	30078680
665	Phosphorylation	LEDGRTLSDYNIQKE CCCCCCCCCCCCCCH	37.12	30078680
739	Phosphorylation	KQLEDGRTLSDYNIQ CCCCCCCCCCCCCCC	35.82	30078680
741	Phosphorylation	LEDGRTLSDYNIQKE CCCCCCCCCCCCCCH	37.12	30078680
815	Phosphorylation	KQLEDGRTLSDYNIQ CCCCCCCCCCCCCCC	35.82	30078680
817	Phosphorylation	LEDGRTLSDYNIQKE CCCCCCCCCCCCCCH	37.12	30078680

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UBIQ1_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UBIQ1_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UBIQ1_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LIN23_CAEEL	lin-23	genetic	15820693

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.