UniProt ID | MEX6_CAEEL | |
---|---|---|
UniProt AC | Q09436 | |
Protein Name | Zinc finger protein mex-6 | |
Gene Name | mex-6 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 467 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Functions with mex-5 to affect embryonic viability, establish soma germline asymmetry in embryos and establish plk-1, pie-1, mex-1, and pos-1 asymmetry in embryos. [PubMed: 10882103] | |
Protein Sequence | MTATSNSAPLAGGSLSSSATAQPPQPPPGHQQQHPLPQIYDSQMQYYYGSSMPNQPIPTYTAQNGAPQQFGTPPYYQDANGQFGQVPAQQQMMTAGHPYFYMAQPQQGGQHVAQSGQPQIFYYQQPLGQMAQQAAPMYFHPMQAASTPMLSEQMSMMPQIQSTNPQQSEQLRKSGAQISTTRTVPLTSSTPLPTSREYETVQRDRNRNSQSRYQCPIEHDDLPIDEISKITIDNHNDDTMSAEKENRFNKNRVEKLGRRGFAKPEVDSQLPHNFKTRLCMTHAAGINPCALGARCKFAHGLKELRASDIPTRYPNNKYKTKLCKNFARGGSGVCPYGLRCEFVHPSDTEFQNIPPYQRKMVEEHDSIPEDYVVARYQPRFMHTSGKATTPTKVTLKQRNVAGSMMCLSNTGRDLEAGGDFNHPEINENDLPPHLRRIRRGNPPVTRSRPSFSTKWTSVENLGLRGHY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
190 | Phosphorylation | TVPLTSSTPLPTSRE EECCCCCCCCCCCCC | 28.72 | 18199581 | |
239 | Phosphorylation | IDNHNDDTMSAEKEN ECCCCCCCCCHHHHH | 18.85 | 30078680 | |
241 | Phosphorylation | NHNDDTMSAEKENRF CCCCCCCCHHHHHCC | 35.05 | 30078680 | |
366 | Phosphorylation | KMVEEHDSIPEDYVV HHHHHCCCCCHHHHH | 41.78 | 30078680 | |
457 | Phosphorylation | SFSTKWTSVENLGLR CCCCCCEEHHHCCCC | 26.73 | 19530675 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MEX6_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MEX6_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MEX6_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MEX6_CAEEL | mex-6 | physical | 18692475 | |
CO4A1_CAEEL | emb-9 | physical | 18692475 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...