dbPTM

MEX6_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MEX6_CAEEL
UniProt AC	Q09436
Protein Name	Zinc finger protein mex-6
Gene Name	mex-6
Organism	Caenorhabditis elegans.
Sequence Length	467
Subcellular Localization	Cytoplasm .
Protein Description	Functions with mex-5 to affect embryonic viability, establish soma germline asymmetry in embryos and establish plk-1, pie-1, mex-1, and pos-1 asymmetry in embryos. [PubMed: 10882103]
Protein Sequence	MTATSNSAPLAGGSLSSSATAQPPQPPPGHQQQHPLPQIYDSQMQYYYGSSMPNQPIPTYTAQNGAPQQFGTPPYYQDANGQFGQVPAQQQMMTAGHPYFYMAQPQQGGQHVAQSGQPQIFYYQQPLGQMAQQAAPMYFHPMQAASTPMLSEQMSMMPQIQSTNPQQSEQLRKSGAQISTTRTVPLTSSTPLPTSREYETVQRDRNRNSQSRYQCPIEHDDLPIDEISKITIDNHNDDTMSAEKENRFNKNRVEKLGRRGFAKPEVDSQLPHNFKTRLCMTHAAGINPCALGARCKFAHGLKELRASDIPTRYPNNKYKTKLCKNFARGGSGVCPYGLRCEFVHPSDTEFQNIPPYQRKMVEEHDSIPEDYVVARYQPRFMHTSGKATTPTKVTLKQRNVAGSMMCLSNTGRDLEAGGDFNHPEINENDLPPHLRRIRRGNPPVTRSRPSFSTKWTSVENLGLRGHY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
190	Phosphorylation	TVPLTSSTPLPTSRE EECCCCCCCCCCCCC	28.72	18199581
239	Phosphorylation	IDNHNDDTMSAEKEN ECCCCCCCCCHHHHH	18.85	30078680
241	Phosphorylation	NHNDDTMSAEKENRF CCCCCCCCHHHHHCC	35.05	30078680
366	Phosphorylation	KMVEEHDSIPEDYVV HHHHHCCCCCHHHHH	41.78	30078680
457	Phosphorylation	SFSTKWTSVENLGLR CCCCCCEEHHHCCCC	26.73	19530675

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MEX6_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MEX6_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MEX6_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
MEX6_CAEEL	mex-6	physical	18692475
CO4A1_CAEEL	emb-9	physical	18692475

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MEX6_CAEEL

Related Literatures of Post-Translational Modification