UniProt ID | TNFL6_HUMAN | |
---|---|---|
UniProt AC | P48023 | |
Protein Name | Tumor necrosis factor ligand superfamily member 6 | |
Gene Name | FASLG | |
Organism | Homo sapiens (Human). | |
Sequence Length | 281 | |
Subcellular Localization |
Cell membrane Single-pass type II membrane protein . Cytoplasmic vesicle lumen . Lysosome lumen . Is internalized into multivesicular bodies of secretory lysosomes after phosphorylation by FGR and monoubiquitination (PubMed:17164290). Colocalizes w |
|
Protein Description | Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. [PubMed: 26334989] | |
Protein Sequence | MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
82 | S-palmitoylation | GNHSTGLCLLVMFFM CCHHHHHHHHHHHHH | 2.67 | 21368861 | |
135 | Phosphorylation | EKQIGHPSPPPEKKE HHHHCCCCCCCCHHH | 44.35 | 21964256 | |
184 | N-linked_Glycosylation | KKGGLVINETGLYFV EECCEEECCCCCEEE | 33.04 | UniProtKB CARBOHYD | |
184 | N-linked_Glycosylation | KKGGLVINETGLYFV EECCEEECCCCCEEE | 33.04 | 9405425 | |
208 | Phosphorylation | SCNNLPLSHKVYMRN CCCCCCCCCEEEECC | 21.23 | 23532336 | |
212 | Phosphorylation | LPLSHKVYMRNSKYP CCCCCEEEECCCCCC | 8.65 | 23532336 | |
231 | Phosphorylation | MMEGKMMSYCTTGQM EECCEEHHHCCHHHH | 17.35 | 23312004 | |
232 | Phosphorylation | MEGKMMSYCTTGQMW ECCEEHHHCCHHHHH | 3.95 | 23312004 | |
234 | Phosphorylation | GKMMSYCTTGQMWAR CEEHHHCCHHHHHHH | 26.23 | - | |
250 | N-linked_Glycosylation | SYLGAVFNLTSADHL HHHHHHHCCCCCCEE | 35.49 | UniProtKB CARBOHYD | |
250 | N-linked_Glycosylation | SYLGAVFNLTSADHL HHHHHHHCCCCCCEE | 35.49 | 9405425 | |
260 | N-linked_Glycosylation | SADHLYVNVSELSLV CCCEEEEEHHHEEEE | 20.31 | UniProtKB CARBOHYD | |
260 | N-linked_Glycosylation | SADHLYVNVSELSLV CCCEEEEEHHHEEEE | 20.31 | 9405425 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TNFL6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TNFL6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TNFL6_HUMAN !! |
loading...