| UniProt ID | CFLAR_HUMAN | |
|---|---|---|
| UniProt AC | O15519 | |
| Protein Name | CASP8 and FADD-like apoptosis regulator | |
| Gene Name | CFLAR | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 480 | |
| Subcellular Localization | ||
| Protein Description | Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity.. | |
| Protein Sequence | MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 49 | Ubiquitination | DILRERGKLSVGDLA HHHHHCCCCCHHHHH | 43.75 | - | |
| 51 | Phosphorylation | LRERGKLSVGDLAEL HHHCCCCCHHHHHHH | 27.78 | 22210691 | |
| 60 | Phosphorylation | GDLAELLYRVRRFDL HHHHHHHHHHHHHHH | 21.49 | 22210691 | |
| 77 | Ubiquitination | RILKMDRKAVETHLL HHHHCCHHHHHHHHH | 53.14 | - | |
| 96 (in isoform 7) | Ubiquitination | - | 1.67 | 21890473 | |
| 96 (in isoform 4) | Ubiquitination | - | 1.67 | 21890473 | |
| 96 (in isoform 3) | Ubiquitination | - | 1.67 | 21890473 | |
| 96 | Ubiquitination | LVSDYRVLMAEIGED HHCCHHHHHHHHCCC | 1.67 | 21890473 | |
| 107 | Phosphorylation | IGEDLDKSDVSSLIF HCCCCCCCHHHHHHH | 42.80 | 28270605 | |
| 110 | Phosphorylation | DLDKSDVSSLIFLMK CCCCCHHHHHHHHHH | 25.15 | 28270605 | |
| 111 | Phosphorylation | LDKSDVSSLIFLMKD CCCCHHHHHHHHHHH | 25.90 | 28270605 | |
| 119 | Phosphorylation | LIFLMKDYMGRGKIS HHHHHHHHCCCCCCC | 8.92 | 28270605 | |
| 122 | Methylation | LMKDYMGRGKISKEK HHHHHCCCCCCCCCC | 27.05 | - | |
| 154 | Ubiquitination | DQLDLLEKCLKNIHR HHHHHHHHHHHHHHH | 44.85 | - | |
| 157 | Ubiquitination | DLLEKCLKNIHRIDL HHHHHHHHHHHHCCH | 64.42 | - | |
| 166 | Phosphorylation | IHRIDLKTKIQKYKQ HHHCCHHHHHHHHHH | 40.45 | - | |
| 167 | Ubiquitination | HRIDLKTKIQKYKQS HHCCHHHHHHHHHHH | 41.37 | - | |
| 171 | Phosphorylation | LKTKIQKYKQSVQGA HHHHHHHHHHHHCCC | 9.63 | - | |
| 172 | Ubiquitination | KTKIQKYKQSVQGAG HHHHHHHHHHHCCCC | 43.03 | - | |
| 173 (in isoform 6) | Ubiquitination | - | 45.83 | 21890473 | |
| 182 | Phosphorylation | VQGAGTSYRNVLQAA HCCCCHHHHHHHHHH | 13.17 | - | |
| 192 (in isoform 10) | Ubiquitination | - | 52.20 | 21890473 | |
| 192 (in isoform 5) | Ubiquitination | - | 52.20 | 21890473 | |
| 192 | Ubiquitination | VLQAAIQKSLKDPSN HHHHHHHHHCCCCCC | 52.20 | 21890473 | |
| 192 (in isoform 1) | Ubiquitination | - | 52.20 | 21890473 | |
| 192 (in isoform 2) | Ubiquitination | - | 52.20 | 21890473 | |
| 192 (in isoform 11) | Ubiquitination | - | 52.20 | 21890473 | |
| 192 (in isoform 12) | Ubiquitination | - | 52.20 | 21890473 | |
| 192 (in isoform 13) | Ubiquitination | - | 52.20 | 21890473 | |
| 192 (in isoform 14) | Ubiquitination | - | 52.20 | 21890473 | |
| 192 (in isoform 8) | Ubiquitination | - | 52.20 | 21890473 | |
| 192 (in isoform 9) | Ubiquitination | - | 52.20 | 21890473 | |
| 192 | Ubiquitination | VLQAAIQKSLKDPSN HHHHHHHHHCCCCCC | 52.20 | 21890473 | |
| 193 | Phosphorylation | LQAAIQKSLKDPSNN HHHHHHHHCCCCCCC | 25.03 | 22817900 | |
| 195 | Ubiquitination | AAIQKSLKDPSNNFR HHHHHHCCCCCCCCC | 74.76 | - | |
| 214 | Ubiquitination | RSKEQRLKEQLGAQQ CCHHHHHHHHHCCCC | 45.67 | - | |
| 225 | Ubiquitination | GAQQEPVKKSIQESE CCCCCCHHHHHHHHH | 52.06 | - | |
| 226 | Ubiquitination | AQQEPVKKSIQESEA CCCCCHHHHHHHHHH | 53.69 | - | |
| 227 | Phosphorylation | QQEPVKKSIQESEAF CCCCHHHHHHHHHHC | 24.64 | - | |
| 231 | Phosphorylation | VKKSIQESEAFLPQS HHHHHHHHHHCCCCC | 20.18 | - | |
| 248 | Phosphorylation | EERYKMKSKPLGICL HHHHCCCCCCCEEEE | 35.69 | 24719451 | |
| 254 | S-nitrosocysteine | KSKPLGICLIIDCIG CCCCCEEEEEEECCC | 1.80 | - | |
| 254 | S-nitrosylation | KSKPLGICLIIDCIG CCCCCEEEEEEECCC | 1.80 | 22178444 | |
| 259 | S-nitrosocysteine | GICLIIDCIGNETEL EEEEEEECCCCHHHH | 2.78 | - | |
| 259 | S-nitrosylation | GICLIIDCIGNETEL EEEEEEECCCCHHHH | 2.78 | 22178444 | |
| 270 | Phosphorylation | ETELLRDTFTSLGYE HHHHHHHHHHHHHHH | 23.52 | 26503892 | |
| 272 | Phosphorylation | ELLRDTFTSLGYEVQ HHHHHHHHHHHHHHH | 25.74 | 26503892 | |
| 273 | Phosphorylation | LLRDTFTSLGYEVQK HHHHHHHHHHHHHHH | 18.66 | 19339247 | |
| 314 | Phosphorylation | SFVCVLVSRGGSQSV CEEEEEEECCCCCCE | 22.50 | - | |
| 370 | Phosphorylation | SEGQLEDSSLLEVDG ECCCCCCCCCEEECC | 17.32 | 26503514 | |
| 371 | Phosphorylation | EGQLEDSSLLEVDGP CCCCCCCCCEEECCC | 49.66 | 26503514 | |
| 386 | Ubiquitination | AMKNVEFKAQKRGLC CCCCCCHHHHHCCCE | 36.08 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 193 | S | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
| 193 | S | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
| 193 | S | Phosphorylation | Kinase | PRKCB | P05771 | GPS |
| 193 | S | Phosphorylation | Kinase | PRKCB | P05771 | GPS |
| 273 | S | Phosphorylation | Kinase | AKT1 | P31749 | PSP |
| - | K | Ubiquitination | E3 ubiquitin ligase | ITCH | Q96J02 | PMID:22199232 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CFLAR_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CFLAR_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
