UniProt ID | B9D2_HUMAN | |
---|---|---|
UniProt AC | Q9BPU9 | |
Protein Name | B9 domain-containing protein 2 | |
Gene Name | B9D2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 175 | |
Subcellular Localization | Cytoplasm, cytoskeleton, cilium basal body . Cytoplasm, cytoskeleton, cilium axoneme . Nucleus. | |
Protein Description | Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes.. | |
Protein Sequence | MAEVHVIGQIIGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
37 | Phosphorylation | GAAWKLLSGVREGQT HHHHHHHHCCCCCCC | 45.75 | 24719451 | |
139 | Phosphorylation | PQLLHGDTIYSGADR CCCCCCCEEECCCCE | 26.80 | 28796482 | |
141 | Phosphorylation | LLHGDTIYSGADRYR CCCCCEEECCCCEEE | 11.80 | 28796482 | |
142 | Phosphorylation | LHGDTIYSGADRYRL CCCCEEECCCCEEEE | 24.53 | 28796482 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of B9D2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of B9D2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of B9D2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...