| UniProt ID | B9D1_HUMAN | |
|---|---|---|
| UniProt AC | Q9UPM9 | |
| Protein Name | B9 domain-containing protein 1 | |
| Gene Name | B9D1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 204 | |
| Subcellular Localization | Cytoplasm, cytoskeleton, cilium basal body . Cytoplasm, cytoskeleton, cilium axoneme . Localizes at the transition zone, a region between the basal body and the ciliary axoneme.. | |
| Protein Description | Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling (By similarity).. | |
| Protein Sequence | MATASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSWFMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLLFNVVTKDMRKLGYDTGPSDTQGVLGPSPPQSFPQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 111 | Phosphorylation | GAVHVPFSPGRHKRT CEEECCCCCCCCCCC | 22.00 | 25159151 | |
| 126 | Phosphorylation | IPMFVPESTSKLQKF EEEECCCCHHHHHHH | 31.73 | 28555341 | |
| 128 | Phosphorylation | MFVPESTSKLQKFTS EECCCCHHHHHHHHH | 40.42 | 28555341 | |
| 129 | Ubiquitination | FVPESTSKLQKFTSW ECCCCHHHHHHHHHH | 55.83 | - | |
| 132 | Ubiquitination | ESTSKLQKFTSWFMG CCHHHHHHHHHHHHC | 62.13 | 21890473 | |
| 132 (in isoform 1) | Ubiquitination | - | 62.13 | 21890473 | |
| 180 | Acetylation | VVTKDMRKLGYDTGP EECHHHHHHCCCCCC | 39.36 | 7369705 | |
| 180 | Ubiquitination | VVTKDMRKLGYDTGP EECHHHHHHCCCCCC | 39.36 | 21890473 | |
| 180 (in isoform 1) | Ubiquitination | - | 39.36 | 21890473 | |
| 183 | Phosphorylation | KDMRKLGYDTGPSDT HHHHHHCCCCCCCCC | 22.29 | - | |
| 197 | Phosphorylation | TQGVLGPSPPQSFPQ CCCCCCCCCCCCCCC | 47.62 | 28555341 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of B9D1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of B9D1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of B9D1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TCPB_HUMAN | CCT2 | physical | 26638075 | |
| TCPG_HUMAN | CCT3 | physical | 26638075 | |
| TCPD_HUMAN | CCT4 | physical | 26638075 | |
| TCPE_HUMAN | CCT5 | physical | 26638075 | |
| TCPZ_HUMAN | CCT6A | physical | 26638075 | |
| TCPH_HUMAN | CCT7 | physical | 26638075 | |
| TCPQ_HUMAN | CCT8 | physical | 26638075 | |
| COQ6_HUMAN | COQ6 | physical | 26638075 | |
| METH_HUMAN | MTR | physical | 26638075 | |
| PDCL3_HUMAN | PDCL3 | physical | 26638075 | |
| PFD4_HUMAN | PFDN4 | physical | 26638075 | |
| TCPA_HUMAN | TCP1 | physical | 26638075 | |
| TXND9_HUMAN | TXNDC9 | physical | 26638075 | |
| INVS_HUMAN | INVS | physical | 26638075 | |
| RUVB1_HUMAN | RUVBL1 | physical | 26638075 | |
| MKS1_HUMAN | MKS1 | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| OMIM Disease | ||||||
| 614209 | Meckel syndrome 9 (MKS9) | |||||
| Kegg Drug | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
