dbPTM

PDCL3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PDCL3_HUMAN
UniProt AC	Q9H2J4
Protein Name	Phosducin-like protein 3
Gene Name	PDCL3
Organism	Homo sapiens (Human).
Sequence Length	239
Subcellular Localization	Cytoplasm .
Protein Description	Acts as a chaperone for the angiogenic VEGF receptor KDR/VEGFR2, controlling its abundance and inhibiting its ubiquitination and degradation. Modulates the activation of caspases during apoptosis. Is a substrate for Orgyia pseudotsugata multicapsid polyhedrosis virus (OpMNPV) IAP-mediated ubiquitination..
Protein Sequence	MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERAIEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MQDPNADT -------CCCCCCCC	10.33	26059764
17	Ubiquitination	WNDILRKKGILPPKE HHHHHHHCCCCCCHH	44.76	24816145
25	Phosphorylation	GILPPKESLKELEEE CCCCCHHHHHHHHHH	51.36	24719451
27	Ubiquitination	LPPKESLKELEEEAE CCCHHHHHHHHHHHH	70.32	32015554
33	Phosphorylation	LKELEEEAEEEQRIL HHHHHHHHHHHHHHH	32.55	32645325
40	Ubiquitination	AEEEQRILQQSVVKT HHHHHHHHHHHHHHH	4.06	21890473
43	Phosphorylation	EQRILQQSVVKTYED HHHHHHHHHHHHHHC	18.86	25159151
47	Phosphorylation	LQQSVVKTYEDMTLE HHHHHHHHHHCCCHH	22.12	28796482
48	Phosphorylation	QQSVVKTYEDMTLEE HHHHHHHHHCCCHHH	12.29	28796482
52	Phosphorylation	VKTYEDMTLEELEDH HHHHHCCCHHHHHHC	43.25	29978859
83	Ubiquitination	RRRLAEWKATKLKNK HHHHHHHHHHHHHHH	37.37	32015554
90	Acetylation	KATKLKNKFGEVLEI HHHHHHHHHCCEEEE	53.83	27452117
90	Ubiquitination	KATKLKNKFGEVLEI HHHHHHHHHCCEEEE	53.83	21890473
205	Sulfoxidation	LSESGAIMTDLEENP HCCCCCCCCCCHHCC	2.06	21406390
206	Phosphorylation	SESGAIMTDLEENPK CCCCCCCCCCHHCCC	31.18	-
222	Phosphorylation	PIEDVLLSSVRRSVL CHHHHHHHHHHHHHH	23.72	24719451
223	Phosphorylation	IEDVLLSSVRRSVLM HHHHHHHHHHHHHHH	21.44	28857561
227	Phosphorylation	LLSSVRRSVLMKRDS HHHHHHHHHHHCCCC	14.72	23403867
231	Acetylation	VRRSVLMKRDSDSEG HHHHHHHCCCCCCCC	49.22	30591189
234	Phosphorylation	SVLMKRDSDSEGD-- HHHHCCCCCCCCC--	47.25	28355574
236	Phosphorylation	LMKRDSDSEGD---- HHCCCCCCCCC----	47.64	23927012

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PDCL3_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PDCL3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PDCL3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TCPG_HUMAN	CCT3	physical	26344197
TCPZ_HUMAN	CCT6A	physical	26344197
TCPH_HUMAN	CCT7	physical	26344197
TCPQ_HUMAN	CCT8	physical	26344197

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PDCL3_HUMAN

Related Literatures of Post-Translational Modification

Acetylation
Reference	PubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY.	19413330 [Abstract]
Phosphorylation
Reference	PubMed
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-43; SER-234 AND SER-236,AND MASS SPECTROMETRY.	18669648 [Abstract]
"Global phosphoproteome of HT-29 human colon adenocarcinoma cells."; Kim J.-E., Tannenbaum S.R., White F.M.; J. Proteome Res. 4:1339-1346(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-234 AND SER-236, ANDMASS SPECTROMETRY.	16083285 [Abstract]