UniProt ID | TXND9_HUMAN | |
---|---|---|
UniProt AC | O14530 | |
Protein Name | Thioredoxin domain-containing protein 9 | |
Gene Name | TXNDC9 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 226 | |
Subcellular Localization | Cytoplasm . Nucleus . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Midbody . Co-localizes with beta-tubulin in the centrosome. | |
Protein Description | Significantly diminishes the chaperonin TCP1 complex ATPase activity, thus negatively impacts protein folding, including that of actin or tubulin.. | |
Protein Sequence | MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Phosphorylation | LEHQLLQTTKLVEEH HHHHHHHHHHHHHHH | 26.35 | 28555341 | |
22 | Phosphorylation | EHQLLQTTKLVEEHL HHHHHHHHHHHHHHH | 14.93 | 28555341 | |
23 | Ubiquitination | HQLLQTTKLVEEHLD HHHHHHHHHHHHHHH | 54.65 | 32015554 | |
35 | Ubiquitination | HLDSEIQKLDQMDED HHHHHHHHHHCCCHH | 60.74 | - | |
48 | Ubiquitination | EDELERLKEKRLQAL HHHHHHHHHHHHHHH | 68.37 | 29967540 | |
57 | Ubiquitination | KRLQALRKAQQQKQE HHHHHHHHHHHHHHH | 51.93 | 22817900 | |
62 | Ubiquitination | LRKAQQQKQEWLSKG HHHHHHHHHHHHHCC | 45.94 | 21890473 | |
62 | Ubiquitination | LRKAQQQKQEWLSKG HHHHHHHHHHHHHCC | 45.94 | 21906983 | |
68 | Ubiquitination | QKQEWLSKGHGEYRE HHHHHHHCCCCCCCC | 53.40 | 29967540 | |
78 | Phosphorylation | GEYREIPSERDFFQE CCCCCCCCCCCHHHH | 51.42 | 24719451 | |
87 | Ubiquitination | RDFFQEVKESENVVC CCHHHHHHHHCCEEE | 55.56 | 21963094 | |
116 | Ubiquitination | RHLAILSKKHLETKF HHHHHHCHHHHHHHC | 40.54 | 29967540 | |
116 | Acetylation | RHLAILSKKHLETKF HHHHHHCHHHHHHHC | 40.54 | 26210075 | |
117 | Ubiquitination | HLAILSKKHLETKFL HHHHHCHHHHHHHCC | 50.47 | - | |
122 | Acetylation | SKKHLETKFLKLNVE CHHHHHHHCCCCCHH | 39.05 | 27452117 | |
125 | Ubiquitination | HLETKFLKLNVEKAP HHHHHCCCCCHHHHH | 40.94 | 29967540 | |
130 | Ubiquitination | FLKLNVEKAPFLCER CCCCCHHHHHHHHHH | 58.01 | 29967540 | |
141 | Ubiquitination | LCERLHIKVIPTLAL HHHHHCCEEEEEEEE | 24.30 | 22817900 | |
145 | Phosphorylation | LHIKVIPTLALLKDG HCCEEEEEEEECCCC | 17.34 | 21406692 | |
150 | Ubiquitination | IPTLALLKDGKTQDY EEEEEECCCCCCCEE | 66.34 | 29967540 | |
153 | Ubiquitination | LALLKDGKTQDYVVG EEECCCCCCCEEEEE | 53.82 | - | |
181 | Phosphorylation | TLEWRLGSSDILNYS CEEECCCCCCCCCCC | 29.45 | 28102081 | |
182 | Phosphorylation | LEWRLGSSDILNYSG EEECCCCCCCCCCCC | 27.20 | 28102081 | |
187 | Phosphorylation | GSSDILNYSGNLMEP CCCCCCCCCCCCCCC | 17.95 | 21712546 | |
188 | Phosphorylation | SSDILNYSGNLMEPP CCCCCCCCCCCCCCC | 21.82 | 25159151 | |
201 | Ubiquitination | PPFQNQKKFGTNFTK CCCCCCCCCCCCCCH | 38.98 | 29967540 | |
204 | Phosphorylation | QNQKKFGTNFTKLEK CCCCCCCCCCCHHCC | 30.23 | 28555341 | |
208 | Ubiquitination | KFGTNFTKLEKKTIR CCCCCCCHHCCCCCC | 50.97 | 33845483 | |
208 | Acetylation | KFGTNFTKLEKKTIR CCCCCCCHHCCCCCC | 50.97 | 25953088 | |
219 | Phosphorylation | KTIRGKKYDSDSDDD CCCCCCCCCCCCCCC | 24.94 | 24275569 | |
221 | Phosphorylation | IRGKKYDSDSDDD-- CCCCCCCCCCCCC-- | 35.60 | 26055452 | |
223 | Phosphorylation | GKKYDSDSDDD---- CCCCCCCCCCC---- | 47.06 | 26055452 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TXND9_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TXND9_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TXND9_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-188, AND MASSSPECTROMETRY. | |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-188, AND MASSSPECTROMETRY. |