UniProt ID | SHBG_HUMAN | |
---|---|---|
UniProt AC | P04278 | |
Protein Name | Sex hormone-binding globulin | |
Gene Name | SHBG | |
Organism | Homo sapiens (Human). | |
Sequence Length | 402 | |
Subcellular Localization | Secreted. In testis, it is synthesized by the Sertoli cells, secreted into the lumen of the seminiferous tubule and transported to the epididymis.. | |
Protein Description | Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration.. | |
Protein Sequence | MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MESRGPLATS -----CCCCCHHHHH | 41.04 | - | |
36 | O-linked_Glycosylation | ALRPVLPTQSAHDPP CCCCCCCCCCCCCCC | 30.87 | 3542030 | |
72 | Phosphorylation | KITKTSSSFEVRTWD EEEECCCCEEEEEEC | 25.78 | - | |
86 | Phosphorylation | DPEGVIFYGDTNPKD CCCCEEEECCCCCCC | 11.72 | 17322306 | |
161 | Phosphorylation | RQVSGPLTSKRHPIM EEECCCCCCCCCCCC | 35.02 | - | |
162 | Phosphorylation | QVSGPLTSKRHPIMR EECCCCCCCCCCCCH | 35.06 | - | |
207 | Phosphorylation | LDKQAEISASAPTSL HHHHCEECCCCCCCH | 14.00 | 29083192 | |
209 | Phosphorylation | KQAEISASAPTSLRS HHCEECCCCCCCHHC | 28.17 | 29083192 | |
212 | Phosphorylation | EISASAPTSLRSCDV EECCCCCCCHHCCCC | 39.86 | 29083192 | |
380 | N-linked_Glycosylation | LDVDQALNRSHEIWT CCHHHHHHCCCCCEE | 46.56 | 18638581 | |
380 | N-linked_Glycosylation | LDVDQALNRSHEIWT CCHHHHHHCCCCCEE | 46.56 | 16335952 | |
396 | N-linked_Glycosylation | SCPQSPGNGTDASH- CCCCCCCCCCCCCC- | 54.28 | 3542030 | |
396 | N-linked_Glycosylation | SCPQSPGNGTDASH- CCCCCCCCCCCCCC- | 54.28 | 17623646 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SHBG_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SHBG_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
72 | Phosphorylation | 69 (3) | P ⇒ Q;L | rs6258 |
| 21998597 22829776 |
120 | N-linked Glycosylation | 127 (7) | P ⇒ L;Q | rs6258 |
| 21998597 22829776 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Molecular analyses of a human sex hormone-binding globulin variant:evidence for an additional carbohydrate chain."; Power S.G.A., Bocchinfuso W.P., Pallesen M., Warmels-Rodenhiser S.,Van Baelen H., Hammond G.L.; J. Clin. Endocrinol. Metab. 75:1066-1070(1992). Cited for: VARIANT ASN-356, AND GLYCOSYLATION AT ASN-356. | |
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-380, AND MASSSPECTROMETRY. | |
"Human plasma N-glycoproteome analysis by immunoaffinity subtraction,hydrazide chemistry, and mass spectrometry."; Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E.,Moore R.J., Smith R.D.; J. Proteome Res. 4:2070-2080(2005). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-380, AND MASSSPECTROMETRY. | |
"Amino acid sequence of the sex steroid binding protein of human bloodplasma."; Walsh K.A., Titani K., Takio K., Kumar S., Hayes R., Petra P.H.; Biochemistry 25:7584-7590(1986). Cited for: PROTEIN SEQUENCE OF 30-402. |