UniProt ID | MPU1_HUMAN | |
---|---|---|
UniProt AC | O75352 | |
Protein Name | Mannose-P-dolichol utilization defect 1 protein | |
Gene Name | MPDU1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 247 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | Required for normal utilization of mannose-dolichol phosphate (Dol-P-Man) in the synthesis of N-linked and O-linked oligosaccharides and GPI anchors.. | |
Protein Sequence | MAAEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQVFKILGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLMLQTITICFLVMHYRGQTVKGVAFLACYGLVLLVLLSPLTPLTVVTLLQASNVPAVVVGRLLQAATNYHNGHTGQLSAITVFLLFGGSLARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPPHKQKKAQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAEADGPL ------CCCCCCCCH | 17.63 | 25944712 | |
10 | Ubiquitination | AEADGPLKRLLVPIL CCCCCCHHHHHHHHH | 44.10 | - | |
10 | Ubiquitination | AEADGPLKRLLVPIL CCCCCCHHHHHHHHH | 44.10 | - | |
10 | 2-Hydroxyisobutyrylation | AEADGPLKRLLVPIL CCCCCCHHHHHHHHH | 44.10 | - | |
43 | Phosphorylation | PCLKILLSKGLGLGI HHHHHHHHCCCCCCH | 22.64 | - | |
44 | Ubiquitination | CLKILLSKGLGLGIV HHHHHHHCCCCCCHH | 59.11 | - | |
54 | Phosphorylation | GLGIVAGSLLVKLPQ CCCHHHHHHHHHHHH | 14.59 | - | |
64 | Ubiquitination | VKLPQVFKILGAKSA HHHHHHHHHHCCCCC | 37.86 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPU1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MPU1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPU1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MO4L2_HUMAN | MORF4L2 | physical | 17353931 | |
PMVK_HUMAN | PMVK | physical | 17353931 | |
AAAT_HUMAN | SLC1A5 | physical | 17353931 | |
QRIC2_HUMAN | QRICH2 | physical | 17353931 | |
RS3A_HUMAN | RPS3A | physical | 17353931 | |
HERC2_HUMAN | HERC2 | physical | 17353931 |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |