MT1F_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MT1F_HUMAN
• UniProt AC: P04733
• Protein Name: Metallothionein-1F
• Gene Name: MT1F
• Organism: Homo sapiens (Human).
• Sequence Length: 61
• Protein Description: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids..
• Protein Sequence: MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDPNCSCA -------CCCCCCCC	20.42	-
6	Phosphorylation	--MDPNCSCAAGVSC --CCCCCCCCCCCCE	17.27	23927012
12	Phosphorylation	CSCAAGVSCTCAGSC CCCCCCCCEEECCCC	11.64	23927012
14	Phosphorylation	CAAGVSCTCAGSCKC CCCCCCEEECCCCCC	9.63	23927012
27	Phosphorylation	KCKECKCTSCKKSCC CCCCCCCCCCCCCCC	23.74	30576142
28	Phosphorylation	CKECKCTSCKKSCCS CCCCCCCCCCCCCCC	33.15	30576142
32	Phosphorylation	KCTSCKKSCCSCCPV CCCCCCCCCCCCCCC	13.07	30576142
35	Phosphorylation	SCKKSCCSCCPVGCS CCCCCCCCCCCCCCC	24.07	30576142
42	Phosphorylation	SCCPVGCSKCAQGCV CCCCCCCCHHHCCCE	25.49	30576142
51	Ubiquitination	CAQGCVCKGASEKCS HHCCCEECCHHHCCC	36.79	-
58	Phosphorylation	KGASEKCSCCD---- CCHHHCCCCCC----	28.93	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MT1F_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MT1F_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MT1F_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NOP2_HUMAN	NOP2	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.