MT1G_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MT1G_HUMAN
• UniProt AC: P13640
• Protein Name: Metallothionein-1G
• Gene Name: MT1G
• Organism: Homo sapiens (Human).
• Sequence Length: 62
• Protein Description: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids..
• Protein Sequence: MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDPNCSCA -------CCCCCCCC	20.42	8119276
6	Phosphorylation	--MDPNCSCAAAGVS --CCCCCCCCCCCCC	17.27	28857561
6 (in isoform 2)	Phosphorylation	-	17.27	24043423
12 (in isoform 2)	Phosphorylation	-	3.49	24043423
13	Phosphorylation	SCAAAGVSCTCASSC CCCCCCCCEEECCCC	11.64	30576142
14 (in isoform 2)	Phosphorylation	-	3.17	24043423
15	Phosphorylation	AAAGVSCTCASSCKC CCCCCCEEECCCCCC	12.00	28857561
17 (in isoform 2)	Phosphorylation	-	6.07	24043423
18 (in isoform 2)	Phosphorylation	-	38.11	24043423
20	Ubiquitination	SCTCASSCKCKECKC CEEECCCCCCCCCCC	5.78	23503661
21	Ubiquitination	CTCASSCKCKECKCT EEECCCCCCCCCCCC	50.73	23503661
22	Ubiquitination	TCASSCKCKECKCTS EECCCCCCCCCCCCC	5.42	23503661
23	Ubiquitination	CASSCKCKECKCTSC ECCCCCCCCCCCCCC	52.20	23503661
25	Ubiquitination	SSCKCKECKCTSCKK CCCCCCCCCCCCCCC	2.41	27667366
26	Ubiquitination	SCKCKECKCTSCKKS CCCCCCCCCCCCCCC	41.46	27667366
30	Ubiquitination	KECKCTSCKKSCCSC CCCCCCCCCCCCCCC	3.29	23503661
31	Ubiquitination	ECKCTSCKKSCCSCC CCCCCCCCCCCCCCC	47.70	23503661
32	Phosphorylation	CKCTSCKKSCCSCCP CCCCCCCCCCCCCCC	53.72	27251275
32	Ubiquitination	CKCTSCKKSCCSCCP CCCCCCCCCCCCCCC	53.72	23503661
33	Phosphorylation	KCTSCKKSCCSCCPV CCCCCCCCCCCCCCC	13.07	22777824
34	S-nitrosylation	CTSCKKSCCSCCPVG CCCCCCCCCCCCCCC	2.45	22178444
35	S-nitrosylation	TSCKKSCCSCCPVGC CCCCCCCCCCCCCCC	4.50	22178444
35	Phosphorylation	TSCKKSCCSCCPVGC CCCCCCCCCCCCCCC	4.50	27251275
36	Phosphorylation	SCKKSCCSCCPVGCA CCCCCCCCCCCCCCC	24.07	28258704
37	S-nitrosylation	CKKSCCSCCPVGCAK CCCCCCCCCCCCCCH	1.57	22178444
38	S-nitrosylation	KKSCCSCCPVGCAKC CCCCCCCCCCCCCHH	1.43	22178444
42	S-nitrosylation	CSCCPVGCAKCAQGC CCCCCCCCCHHHCCC	3.13	22178444
43	Neddylation	SCCPVGCAKCAQGCI CCCCCCCCHHHCCCE	12.20	32015554
43	Ubiquitination	SCCPVGCAKCAQGCI CCCCCCCCHHHCCCE	12.20	29901268
44	Ubiquitination	CCPVGCAKCAQGCIC CCCCCCCHHHCCCEE	33.89	29901268
44	Neddylation	CCPVGCAKCAQGCIC CCCCCCCHHHCCCEE	33.89	32015554
51	Ubiquitination	KCAQGCICKGASEKC HHHCCCEECCCCCCC	3.75	23000965
52	Ubiquitination	CAQGCICKGASEKCS HHCCCEECCCCCCCC	37.28	23000965
56	Ubiquitination	CICKGASEKCSCCA- CEECCCCCCCCCCC-	58.51	23000965
57	Ubiquitination	ICKGASEKCSCCA-- EECCCCCCCCCCC--	29.02	23000965
59	Phosphorylation	KGASEKCSCCA---- CCCCCCCCCCC----	24.25	25072903

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MT1G_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MT1G_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MT1G_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of MT1G_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.