UniProt ID | CDC26_MOUSE | |
---|---|---|
UniProt AC | Q99JP4 | |
Protein Name | Anaphase-promoting complex subunit CDC26 | |
Gene Name | Cdc26 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 85 | |
Subcellular Localization | Nucleus. | |
Protein Description | Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May recruit the E2 ubiquitin-conjugating enzymes to the complex (By similarity).. | |
Protein Sequence | MLRRKPTRLELKLDDIEEFESIRKDLEARKKQKEDVEGVGTSDGEGAAGLSSDPKSREQMINDRIGYKPQLKSNNRTSQFGNFEF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MLRRKPTRLELKLD -CCCCCCCCEEEEHH | 51.42 | - | |
41 | Phosphorylation | EDVEGVGTSDGEGAA HHCCCCCCCCCCCCC | 22.65 | 25521595 | |
42 | Phosphorylation | DVEGVGTSDGEGAAG HCCCCCCCCCCCCCC | 37.38 | 25521595 | |
51 | Phosphorylation | GEGAAGLSSDPKSRE CCCCCCCCCCHHHHH | 31.60 | 25619855 | |
52 | Phosphorylation | EGAAGLSSDPKSREQ CCCCCCCCCHHHHHH | 64.08 | 25619855 | |
67 | Phosphorylation | MINDRIGYKPQLKSN HHHCCCCCCCCCCCC | 19.68 | 29514104 | |
73 | Phosphorylation | GYKPQLKSNNRTSQF CCCCCCCCCCCCCCC | 48.18 | 26643407 | |
77 | Phosphorylation | QLKSNNRTSQFGNFE CCCCCCCCCCCCCCC | 29.07 | 26643407 | |
78 | Phosphorylation | LKSNNRTSQFGNFEF CCCCCCCCCCCCCCC | 21.92 | 26643407 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDC26_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDC26_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDC26_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...