| UniProt ID | MREG_HUMAN | |
|---|---|---|
| UniProt AC | Q8N565 | |
| Protein Name | Melanoregulin | |
| Gene Name | MREG | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 214 | |
| Subcellular Localization |
Apical cell membrane Peripheral membrane protein. Localizes to the inner segment and basal outer segment of rods in the retina.. |
|
| Protein Description | Plays a role in the incorporation of pigments into hair. May function in membrane fusion and regulate the biogenesis of disk membranes of photoreceptor rod cells (By similarity).. | |
| Protein Sequence | MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 27 | Ubiquitination | EERALPEKEPLVSDN HHCCCCCCCCCCCCC | 63.79 | 2190698 | |
| 27 (in isoform 1) | Ubiquitination | - | 63.79 | 21906983 | |
| 27 (in isoform 2) | Ubiquitination | - | 63.79 | 21906983 | |
| 37 | Phosphorylation | LVSDNNPYSSFGATL CCCCCCCCCCCCCEE | 21.04 | 25884760 | |
| 38 | Phosphorylation | VSDNNPYSSFGATLV CCCCCCCCCCCCEEE | 22.05 | 29978859 | |
| 39 | Phosphorylation | SDNNPYSSFGATLVR CCCCCCCCCCCEEEC | 23.12 | 25884760 | |
| 43 | Phosphorylation | PYSSFGATLVRDDEK CCCCCCCEEECCCCC | 26.60 | 29978859 | |
| 71 | Phosphorylation | ADDDRTLYNLIVIRN CCCCCEEEEEEEEEC | 13.81 | 27642862 | |
| 92 | Phosphorylation | EEWQKLNYDIHTLRQ HHHHHHCCHHHHHHH | 27.06 | 25884760 | |
| 96 | Phosphorylation | KLNYDIHTLRQVRRE HHCCHHHHHHHHHHH | 24.78 | - | |
| 119 | Ubiquitination | LEDLGFQKEADSLLS HHHCCCHHHHHHHEE | 53.24 | 29967540 | |
| 128 | Phosphorylation | ADSLLSVTKLSTISD HHHHEEHHHHHCCCC | 23.92 | 25627689 | |
| 129 | Ubiquitination | DSLLSVTKLSTISDS HHHEEHHHHHCCCCC | 37.98 | 29967540 | |
| 208 | Phosphorylation | DGQKELHYLPFPSP- CCCCEEECCCCCCC- | 28.79 | 25159151 | |
| 213 | Phosphorylation | LHYLPFPSP------ EECCCCCCC------ | 43.55 | 19664994 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MREG_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MREG_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MREG_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| JIP4_HUMAN | SPAG9 | physical | 26186194 | |
| WDR44_HUMAN | WDR44 | physical | 26186194 | |
| FGFR1_HUMAN | FGFR1 | physical | 26186194 | |
| UBA5_HUMAN | UBA5 | physical | 26186194 | |
| BHMT1_HUMAN | BHMT | physical | 26186194 | |
| JIP4_HUMAN | SPAG9 | physical | 28514442 | |
| UBA5_HUMAN | UBA5 | physical | 28514442 | |
| FGFR1_HUMAN | FGFR1 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
