UniProt ID | MREG_HUMAN | |
---|---|---|
UniProt AC | Q8N565 | |
Protein Name | Melanoregulin | |
Gene Name | MREG | |
Organism | Homo sapiens (Human). | |
Sequence Length | 214 | |
Subcellular Localization |
Apical cell membrane Peripheral membrane protein. Localizes to the inner segment and basal outer segment of rods in the retina.. |
|
Protein Description | Plays a role in the incorporation of pigments into hair. May function in membrane fusion and regulate the biogenesis of disk membranes of photoreceptor rod cells (By similarity).. | |
Protein Sequence | MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | Ubiquitination | EERALPEKEPLVSDN HHCCCCCCCCCCCCC | 63.79 | 2190698 | |
27 (in isoform 1) | Ubiquitination | - | 63.79 | 21906983 | |
27 (in isoform 2) | Ubiquitination | - | 63.79 | 21906983 | |
37 | Phosphorylation | LVSDNNPYSSFGATL CCCCCCCCCCCCCEE | 21.04 | 25884760 | |
38 | Phosphorylation | VSDNNPYSSFGATLV CCCCCCCCCCCCEEE | 22.05 | 29978859 | |
39 | Phosphorylation | SDNNPYSSFGATLVR CCCCCCCCCCCEEEC | 23.12 | 25884760 | |
43 | Phosphorylation | PYSSFGATLVRDDEK CCCCCCCEEECCCCC | 26.60 | 29978859 | |
71 | Phosphorylation | ADDDRTLYNLIVIRN CCCCCEEEEEEEEEC | 13.81 | 27642862 | |
92 | Phosphorylation | EEWQKLNYDIHTLRQ HHHHHHCCHHHHHHH | 27.06 | 25884760 | |
96 | Phosphorylation | KLNYDIHTLRQVRRE HHCCHHHHHHHHHHH | 24.78 | - | |
119 | Ubiquitination | LEDLGFQKEADSLLS HHHCCCHHHHHHHEE | 53.24 | 29967540 | |
128 | Phosphorylation | ADSLLSVTKLSTISD HHHHEEHHHHHCCCC | 23.92 | 25627689 | |
129 | Ubiquitination | DSLLSVTKLSTISDS HHHEEHHHHHCCCCC | 37.98 | 29967540 | |
208 | Phosphorylation | DGQKELHYLPFPSP- CCCCEEECCCCCCC- | 28.79 | 25159151 | |
213 | Phosphorylation | LHYLPFPSP------ EECCCCCCC------ | 43.55 | 19664994 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MREG_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MREG_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MREG_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
JIP4_HUMAN | SPAG9 | physical | 26186194 | |
WDR44_HUMAN | WDR44 | physical | 26186194 | |
FGFR1_HUMAN | FGFR1 | physical | 26186194 | |
UBA5_HUMAN | UBA5 | physical | 26186194 | |
BHMT1_HUMAN | BHMT | physical | 26186194 | |
JIP4_HUMAN | SPAG9 | physical | 28514442 | |
UBA5_HUMAN | UBA5 | physical | 28514442 | |
FGFR1_HUMAN | FGFR1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...