UniProt ID | PEX10_HUMAN | |
---|---|---|
UniProt AC | O60683 | |
Protein Name | Peroxisome biogenesis factor 10 | |
Gene Name | PEX10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 326 | |
Subcellular Localization |
Peroxisome membrane Peripheral membrane protein . |
|
Protein Description | Somewhat implicated in the biogenesis of peroxisomes.. | |
Protein Sequence | MAPAAASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQADPDSGRPLQGSLGPGGRGCSGARRWMRHHTATLTEQQRRALLRAVFVLRQGLACLQRLHVAWFYIHGVFYHLAKRLTGITYLRVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQLYGFRQRQRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MAPAAASPPEVIRA -CCCCCCCCHHHHHH | 35.94 | 29255136 | |
17 | Ubiquitination | EVIRAAQKDEYYRGG HHHHHHHCCHHHHHC | 48.04 | - | |
17 (in isoform 2) | Ubiquitination | - | 48.04 | - | |
27 | Phosphorylation | YYRGGLRSAAGGALH HHHHCHHHHHHHHHH | 27.75 | 24719451 | |
89 | Phosphorylation | SRIHVPSSLRRGVLV HHCCCCCHHHHCCCH | 21.59 | 17081983 | |
136 | Methylation | GSLGPGGRGCSGARR CCCCCCCCCCHHHHH | 49.19 | 115487031 | |
149 | Phosphorylation | RRWMRHHTATLTEQQ HHHHHHHCCCCCHHH | 18.40 | 30576142 | |
153 | Phosphorylation | RHHTATLTEQQRRAL HHHCCCCCHHHHHHH | 27.65 | 30576142 | |
196 | Phosphorylation | YHLAKRLTGITYLRV HHHHHHHHCCEEEEE | 30.48 | 22210691 | |
199 | Phosphorylation | AKRLTGITYLRVRSL HHHHHCCEEEEEECC | 20.18 | 22210691 | |
200 | Phosphorylation | KRLTGITYLRVRSLP HHHHCCEEEEEECCC | 7.21 | 22210691 | |
216 | Phosphorylation | EDLRARVSYRLLGVI HHHHHHHHHHHHHHH | 10.05 | 23828894 | |
261 | Phosphorylation | GLSHRRASLEERAVS HHCHHHHCHHHHHHH | 34.21 | 27794612 | |
281 | Phosphorylation | TLCLEERRHPTATPC HHHHHCCCCCCCCCC | 43.34 | 24719451 | |
321 | Phosphorylation | FPPQKLIYLRHYR-- CCCCCEEEEEECC-- | 14.23 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PEX10_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEX10_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEX10_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PEX12_HUMAN | PEX12 | physical | 10837480 | |
PEX10_HUMAN | PEX10 | physical | 10837480 | |
PEX5_HUMAN | PEX5 | physical | 10837480 | |
PEX12_HUMAN | PEX12 | physical | 12096124 | |
PEX19_HUMAN | PEX19 | physical | 12096124 | |
PEX10_HUMAN | PEX10 | physical | 22493164 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00205 | Zellweger syndrome spectrum, including: Zellweger syndrome (ZS); Adrenoleukodystrophy, neonatal (NAL | |||||
OMIM Disease | ||||||
614870 | Peroxisome biogenesis disorder complementation group 7 (PBD-CG7) | |||||
614870 | Peroxisome biogenesis disorder 6A (PBD6A) | |||||
614871 | Peroxisome biogenesis disorder 6B (PBD6B) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...