UniProt ID | DAB1_HUMAN | |
---|---|---|
UniProt AC | O75553 | |
Protein Name | Disabled homolog 1 | |
Gene Name | DAB1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 588 | |
Subcellular Localization | ||
Protein Description | Adapter molecule functioning in neural development. May regulate SIAH1 activity.. | |
Protein Sequence | MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
43 | Ubiquitination | KGEGVRYKAKLIGID CCCCCCEEEEEECCC | 28.60 | - | |
45 | Ubiquitination | EGVRYKAKLIGIDEV CCCCEEEEEECCCHH | 36.16 | - | |
64 | Phosphorylation | GDKLCQDSMMKLKGV CCCCCHHHHHHHHHH | 8.56 | 26657352 | |
77 | Phosphorylation | GVVAGARSKGEHKQK HHHHCCCCCCCCCCC | 44.47 | 26657352 | |
84 | Sumoylation | SKGEHKQKIFLTISF CCCCCCCCEEEEEEE | 39.98 | - | |
185 (in isoform 5) | Phosphorylation | - | 11.71 | 28674419 | |
185 (in isoform 4) | Phosphorylation | - | 11.71 | 28674419 | |
185 | Phosphorylation | KQCEQAVYQTILEED HHHHHHHHHHHHHHH | 11.71 | 10959835 | |
198 | Phosphorylation | EDVEDPVYQYIVFEA HHCCCCCCEEEEEEC | 10.86 | 11279201 | |
200 | Phosphorylation | VEDPVYQYIVFEAGH CCCCCCEEEEEECCC | 4.95 | 10959835 | |
220 | Phosphorylation | PETEENIYQVPTSQK CCCCCCEEECCCCCC | 18.29 | 19116273 | |
224 | Phosphorylation | ENIYQVPTSQKKEGV CCEEECCCCCCCCCC | 44.95 | 26434552 | |
225 | Phosphorylation | NIYQVPTSQKKEGVY CEEECCCCCCCCCCC | 33.65 | 26434552 | |
232 | Phosphorylation | SQKKEGVYDVPKSQP CCCCCCCCCCCCCCC | 23.29 | 25884760 | |
491 | Phosphorylation | GVAQDTDDCDDFDIS CCCCCCCCCCCCCHH | 39.58 | 12077184 | |
506 | Phosphorylation | QLNLTPVTSTTPSTN HCCCEECCCCCCCCC | 22.89 | - | |
515 | Phosphorylation | TTPSTNSPPTPAPRQ CCCCCCCCCCCCCCC | 38.56 | 12077184 | |
524 | Phosphorylation | TPAPRQSSPSKSSAS CCCCCCCCCCCCCCC | 25.50 | 19472218 | |
526 | Phosphorylation | APRQSSPSKSSASHA CCCCCCCCCCCCCCC | 47.30 | - | |
548 | Phosphorylation | IFEEGFESPSKSEEQ HHHHCCCCCCCCCCC | 32.01 | 12077184 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
524 | S | Phosphorylation | Kinase | CDK5 | Q00535 | Uniprot |
524 | S | Phosphorylation | Kinase | CDK-FAMILY | - | GPS |
524 | S | Phosphorylation | Kinase | CDK_GROUP | - | PhosphoELM |
548 | S | Phosphorylation | Kinase | CDK-FAMILY | - | GPS |
548 | S | Phosphorylation | Kinase | CDK_GROUP | - | PhosphoELM |
- | K | Ubiquitination | E3 ubiquitin ligase | SOCS4 | Q8WXH5 | PMID:24210661 |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
524 | S | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DAB1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...