VENTX_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VENTX_HUMAN
• UniProt AC: O95231
• Protein Name: Homeobox protein VENTX
• Gene Name: VENTX
• Organism: Homo sapiens (Human).
• Sequence Length: 258
• Subcellular Localization: Nucleus .
• Protein Description: May be involved in ventralization..
• Protein Sequence: MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MRLSSSPPRGP ----CCCCCCCCCCH	20.57	23663014
5	Phosphorylation	---MRLSSSPPRGPQ ---CCCCCCCCCCHH	52.00	23663014
6	Phosphorylation	--MRLSSSPPRGPQQ --CCCCCCCCCCHHH	35.23	23663014
83	O-linked_Glycosylation	ERTMAGLSKEPNTLR CCHHCCCCCCCCCCC	33.77	31492838

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VENTX_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VENTX_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VENTX_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VENTX_HUMAN	VENTX	physical	25416956
TBX22_HUMAN	TBX22	physical	25416956
CA094_HUMAN	C1orf94	physical	25416956
KR122_HUMAN	KRTAP12-2	physical	25416956
KR124_HUMAN	KRTAP12-4	physical	25416956
AES_HUMAN	AES	physical	28514442
TLE4_HUMAN	TLE4	physical	28514442
TLE1_HUMAN	TLE1	physical	28514442
TLE3_HUMAN	TLE3	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.