| UniProt ID | CIART_HUMAN | |
|---|---|---|
| UniProt AC | Q8N365 | |
| Protein Name | Circadian-associated transcriptional repressor | |
| Gene Name | CIART | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 385 | |
| Subcellular Localization | Nucleus. Nucleus, PML body. Co-localizes with the CLOCK-ARNTL/BMAL1 heterodimer in the PML body.. | |
| Protein Description | Transcriptional repressor which forms a negative regulatory component of the circadian clock and acts independently of the circadian transcriptional repressors: CRY1, CRY2 and BHLHE41. In a histone deacetylase-dependent manner represses the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Abrogates the interaction of ARNTL/BMAL1 with the transcriptional coactivator CREBBP and can repress the histone acetyl-transferase activity of the CLOCK-ARNTL/BMAL1 heterodimer, reducing histone acetylation of its target genes. Rhythmically binds the E-box elements (5'-CACGTG-3') on circadian gene promoters and its occupancy shows circadian oscillation antiphasic to ARNTL/BMAL1. Interacts with the glucocorticoid receptor (NR3C1) and contributes to the repressive function in the glucocorticoid response (By similarity).. | |
| Protein Sequence | MDSPSSVSSYSSYSLSSSFPTSPVNSDFGFPSDSEREDKGAHGPRPDTVGQRGGSRPSPGPIRCRHRSKVSGNQHTPSHPKQRGSASPMAGSGAKRSRDGELETSLNTQGCTTEGDLLFAQKCKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPQIAAQKSSLGGGKHQLTKHFPSHHSDSAASSPASPMEKMDQTQLGHLALKPKQPWHLTQWPAMNLTWIHTTPICNPPLSSPGTISFSHGPLGTGTGIGVILFLQHGVQPFTHSAPTTPVPPTTASPVIPGEPMKLSGEGPRCYSLPVTLPSDWSYTLSPPSLPTLARKMTIGHREQQRSHPPVAADAHLLNL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 48 | Phosphorylation | AHGPRPDTVGQRGGS CCCCCCCCCCCCCCC | - | ||
| 55 | Phosphorylation | TVGQRGGSRPSPGPI CCCCCCCCCCCCCCC | 29052541 | ||
| 58 | Phosphorylation | QRGGSRPSPGPIRCR CCCCCCCCCCCCCCC | 23312004 | ||
| 68 | Phosphorylation | PIRCRHRSKVSGNQH CCCCCCCCCCCCCCC | - | ||
| 85 | Phosphorylation | SHPKQRGSASPMAGS CCCCCCCCCCCCCCC | 23403867 | ||
| 87 | Phosphorylation | PKQRGSASPMAGSGA CCCCCCCCCCCCCCC | 24719451 | ||
| 97 | Phosphorylation | AGSGAKRSRDGELET CCCCCCCCCCCCEEE | 23403867 | ||
| 223 | Phosphorylation | HHSDSAASSPASPME CCCCCCCCCCCCCHH | - | ||
| 347 | Phosphorylation | VTLPSDWSYTLSPPS EECCCCCCEECCCCC | 22210691 | ||
| 354 | Phosphorylation | SYTLSPPSLPTLARK CEECCCCCHHHHHHH | 22210691 | ||
| 363 | Phosphorylation | PTLARKMTIGHREQQ HHHHHHHCCCCHHHH | 27174698 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CIART_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CIART_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CIART_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| TPM2_HUMAN | TPM2 | physical | 26186194 | |
| ZG16B_HUMAN | ZG16B | physical | 26186194 | |
| TPM2_HUMAN | TPM2 | physical | 28514442 | |
| OGT1_HUMAN | OGT | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
