UniProt ID | GFOD1_HUMAN | |
---|---|---|
UniProt AC | Q9NXC2 | |
Protein Name | Glucose-fructose oxidoreductase domain-containing protein 1 | |
Gene Name | GFOD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 390 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MLPGVGVFGTSLTARVIIPLLKDEGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVCINLPPPLTRQIAVKTLGIGKNVICDRTATPLDAFRMTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYVGEPLVCEVQVHGGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGLLKTFVKQTDHIKGIRQITSDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSAGRLLAVGTDLYGQRNSAPEQELLVQDATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | PGVGVFGTSLTARVI CCCCCCCCCEEEEHH | 14.75 | 30177828 | |
11 | Phosphorylation | GVGVFGTSLTARVII CCCCCCCCEEEEHHH | 24.89 | 30177828 | |
13 | Phosphorylation | GVFGTSLTARVIIPL CCCCCCEEEEHHHHH | 16.51 | 30177828 | |
47 | Phosphorylation | EELAKEMSVPFYTSR HHHHHHCCCCCCCCC | 27.94 | 24719451 | |
158 | Ubiquitination | HGGSLLGKKYNWSCD ECCCCCCCEECCCHH | 52.64 | - | |
204 | Ubiquitination | GLLKTFVKQTDHIKG HHHHHHHHCCCCCCC | 43.20 | - | |
288 | Phosphorylation | DATPVSNSLLPEKAF CCCCCCCCCCCHHHH | 24.63 | 20860994 | |
356 | Phosphorylation | TIKRSSQTGEWQNIA HHHHCCCCCCCEEEE | 38.73 | - | |
384 | Phosphorylation | ISEAMRRSRMSLYC- HHHHHHHHHHCCCC- | 23.21 | 27251275 | |
387 | Phosphorylation | AMRRSRMSLYC---- HHHHHHHCCCC---- | 18.31 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GFOD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GFOD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GFOD1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...