| UniProt ID | KBRS2_HUMAN | |
|---|---|---|
| UniProt AC | Q9NYR9 | |
| Protein Name | NF-kappa-B inhibitor-interacting Ras-like protein 2 | |
| Gene Name | NKIRAS2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 191 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and nuclear localization of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB (By similarity).. | |
| Protein Sequence | MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 19 | Phosphorylation | QASVGKTSILEQLLY CCCCCCHHHHHHHHH | 28.76 | 25954137 | |
| 33 | Phosphorylation | YGNHVVGSEMIETQE HCCCCCCCCEEECCC | 16.63 | 25954137 | |
| 43 | Phosphorylation | IETQEDIYVGSIETD EECCCCEEEEEEECC | 15.87 | 25954137 | |
| 66 (in isoform 4) | Phosphorylation | - | 43.04 | 25159151 | |
| 68 (in isoform 4) | Phosphorylation | - | 17.95 | 25159151 | |
| 77 (in isoform 4) | Phosphorylation | - | 22.85 | - | |
| 118 | Ubiquitination | KEVTIVVLGNKCDLQ CEEEEEEECCCCCHH | 4.30 | 21890473 | |
| 121 | Ubiquitination | TIVVLGNKCDLQEQR EEEEECCCCCHHHHH | 27.59 | - | |
| 140 | Acetylation | DVAQHWAKSEKVKLW HHHHHHHHCCCCEEE | 54.69 | 25953088 | |
| 140 | Ubiquitination | DVAQHWAKSEKVKLW HHHHHHHHCCCCEEE | 54.69 | - | |
| 150 | Phosphorylation | KVKLWEVSVADRRSL CCEEEEEEHHHHHHH | 10.48 | 28857561 | |
| 156 | Phosphorylation | VSVADRRSLLEPFVY EEHHHHHHHHHHHHH | 37.89 | 28857561 | |
| 167 | Ubiquitination | PFVYLASKMTQPQSK HHHHHHHHCCCCCCC | 40.12 | - | |
| 172 (in isoform 2) | Ubiquitination | - | 54.39 | 21890473 | |
| 174 | Ubiquitination | KMTQPQSKSAFPLSR HCCCCCCCCCCCCCC | 40.32 | 2189047 | |
| 174 (in isoform 1) | Ubiquitination | - | 40.32 | 21890473 | |
| 180 | Phosphorylation | SKSAFPLSRKNKGSG CCCCCCCCCCCCCCC | 41.25 | 27535140 | |
| 186 | Phosphorylation | LSRKNKGSGSLDG-- CCCCCCCCCCCCC-- | 27.15 | 19581576 | |
| 188 | Phosphorylation | RKNKGSGSLDG---- CCCCCCCCCCC---- | 25.61 | 19581576 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KBRS2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KBRS2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KBRS2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PAX6_HUMAN | PAX6 | physical | 21988832 | |
| GFOD1_HUMAN | GFOD1 | physical | 28514442 | |
| RGPA2_HUMAN | RALGAPA2 | physical | 28514442 | |
| RGPA1_HUMAN | RALGAPA1 | physical | 28514442 | |
| RLGPB_HUMAN | RALGAPB | physical | 28514442 | |
| GFOD2_HUMAN | GFOD2 | physical | 28514442 | |
| GDS1_HUMAN | RAP1GDS1 | physical | 28514442 | |
| DCA10_HUMAN | DCAF10 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...