GFOD2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GFOD2_HUMAN
• UniProt AC: Q3B7J2
• Protein Name: Glucose-fructose oxidoreductase domain-containing protein 2
• Gene Name: GFOD2
• Organism: Homo sapiens (Human).
• Sequence Length: 385
• Subcellular Localization: Secreted, extracellular space, extracellular matrix.
• Protein Description: Promotes matrix assembly..
• Protein Sequence: MKMLPGVGVFGTGSSARVLVPLLRAEGFTVEALWGKTEEEAKQLAEEMNIAFYTSRTDDILLHQDVDLVCISIPPPLTRQISVKALGIGKNVVCEKAATSVDAFRMVTASRYYPQLMSLVGNVLRFLPAFVRMKQLISEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGRRAEKVHGLLKTFVRQNAAIRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
53	Phosphorylation	EEMNIAFYTSRTDDI HHHCCCEEECCCCCE	8.52	24043423
54	Phosphorylation	EMNIAFYTSRTDDIL HHCCCEEECCCCCEE	12.79	24043423
55	Phosphorylation	MNIAFYTSRTDDILL HCCCEEECCCCCEEE	23.08	24043423
57	Phosphorylation	IAFYTSRTDDILLHQ CCEEECCCCCEEEEC	37.48	24043423
72	Phosphorylation	DVDLVCISIPPPLTR CCCEEEEECCCCCCC	24.74	24043423
78	Phosphorylation	ISIPPPLTRQISVKA EECCCCCCCCEEHHH	26.71	24043423
84	Ubiquitination	LTRQISVKALGIGKN CCCCEEHHHCCCCCC	30.97	-
90	Ubiquitination	VKALGIGKNVVCEKA HHHCCCCCCEEEHHH	44.65	22505724
96	Ubiquitination	GKNVVCEKAATSVDA CCCEEEHHHCCCCHH	37.89	-
100	Phosphorylation	VCEKAATSVDAFRMV EEHHHCCCCHHHHHH	17.17	30576142
108	Phosphorylation	VDAFRMVTASRYYPQ CHHHHHHHHHHHHHH	15.01	25072903
110	Phosphorylation	AFRMVTASRYYPQLM HHHHHHHHHHHHHHH	16.08	25072903
112	Phosphorylation	RMVTASRYYPQLMSL HHHHHHHHHHHHHHH	19.59	25072903
113	Phosphorylation	MVTASRYYPQLMSLV HHHHHHHHHHHHHHH	5.38	25072903
118	Phosphorylation	RYYPQLMSLVGNVLR HHHHHHHHHHHHHHH	28.61	25072903
156	Phosphorylation	DARIYSGSLLSPSYG CCEECCCCCCCCCCC	21.87	30576142
166	Ubiquitination	SPSYGWICDELMGGG CCCCCCCCCHHCCCC	2.41	22817900
166 (in isoform 2)	Ubiquitination	-	2.41	21906983
268	Phosphorylation	VARGADLYGQKNSAT HHCCCCCCCCCCCCC	20.32	30257219
271	Ubiquitination	GADLYGQKNSATQEE CCCCCCCCCCCCHHH	48.81	22817900
271 (in isoform 1)	Ubiquitination	-	48.81	21906983
273	Phosphorylation	DLYGQKNSATQEELL CCCCCCCCCCHHHHH	39.46	30257219
275	Phosphorylation	YGQKNSATQEELLLR CCCCCCCCHHHHHHH	36.01	30257219
303	Phosphorylation	PQDVPLLYLKGMVYM CCCCCEEHHHHHHHH	17.66	24043423
309	Phosphorylation	LYLKGMVYMVQALRQ EHHHHHHHHHHHHHH	5.23	24043423

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GFOD2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GFOD2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GFOD2_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of GFOD2_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.