UniProt ID | FGL1_HUMAN | |
---|---|---|
UniProt AC | Q08830 | |
Protein Name | Fibrinogen-like protein 1 | |
Gene Name | FGL1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 312 | |
Subcellular Localization | Secreted. | |
Protein Description | Has hepatocyte mitogenic activity.. | |
Protein Sequence | MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MAKVFSFILVTTA --CCHHHHHHHHHHH | 17.86 | - | |
154 | Phosphorylation | FVQKHGEYWLGNKNL HHHHHCCEECCCCCE | 15.55 | 29083192 | |
165 | Phosphorylation | NKNLHFLTTQEDYTL CCCEEEEECCCCEEE | 26.03 | 26074081 | |
166 | Phosphorylation | KNLHFLTTQEDYTLK CCEEEEECCCCEEEE | 31.91 | 26074081 | |
170 | Phosphorylation | FLTTQEDYTLKIDLA EEECCCCEEEEEEHH | 17.14 | 26074081 | |
171 | Phosphorylation | LTTQEDYTLKIDLAD EECCCCEEEEEEHHH | 33.62 | 26074081 | |
183 | Phosphorylation | LADFEKNSRYAQYKN HHHHHHCCCCEEECC | 37.42 | 26074081 | |
294 | Phosphorylation | TWHGWWYSLKSVVMK EECCEEEEEEHHHHC | 18.66 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FGL1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FGL1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FGL1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...