UniProt ID | TBE_HUMAN | |
---|---|---|
UniProt AC | Q9UJT0 | |
Protein Name | Tubulin epsilon chain | |
Gene Name | TUBE1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 475 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Associated with pericentriolar material. | |
Protein Description | ||
Protein Sequence | MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTRVVGDGGSISKGKICSLKARAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFRKSAEHCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTSIYPSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSGKLGTTVKPKSLVTSSSGALKKQHKKPFDAMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMVRGNVQISDLRRNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKERFMRLYKKKAHLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIAM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Ubiquitination | GQCGNQIGCCFWDLA CCCCCCCCHHHHHHH | 7.74 | 22817900 | |
19 | Ubiquitination | CGNQIGCCFWDLALR CCCCCCHHHHHHHHH | 3.05 | 22817900 | |
21 | Ubiquitination | NQIGCCFWDLALREH CCCCHHHHHHHHHHH | 5.94 | 22817900 | |
24 | Ubiquitination | GCCFWDLALREHAAV CHHHHHHHHHHHHHH | 11.33 | 27667366 | |
34 | Ubiquitination | EHAAVNQKGIYDEAI HHHHHHCCCCHHHHH | 41.91 | 21906983 | |
37 | Phosphorylation | AVNQKGIYDEAISSF HHHCCCCHHHHHHHH | 19.19 | - | |
39 | Ubiquitination | NQKGIYDEAISSFFR HCCCCHHHHHHHHHH | 30.82 | 22817900 | |
43 | Phosphorylation | IYDEAISSFFRNVDT CHHHHHHHHHHCCCC | 23.45 | 24719451 | |
52 | Ubiquitination | FRNVDTRVVGDGGSI HHCCCCEEECCCCCC | 6.48 | 22817900 | |
55 | Ubiquitination | VDTRVVGDGGSISKG CCCEEECCCCCCCCC | 46.82 | 22817900 | |
61 | Ubiquitination | GDGGSISKGKICSLK CCCCCCCCCCCCEEE | 63.65 | 21906983 | |
63 | Ubiquitination | GGSISKGKICSLKAR CCCCCCCCCCEEEEE | 44.25 | 22817900 | |
68 | Ubiquitination | KGKICSLKARAVLID CCCCCEEEEEEEEEE | 21.38 | 27667366 | |
68 | Acetylation | KGKICSLKARAVLID CCCCCEEEEEEEEEE | 21.38 | 25953088 | |
70 | Ubiquitination | KICSLKARAVLIDME CCCEEEEEEEEEECC | 24.52 | 22817900 | |
83 | Ubiquitination | MEEGVVNEILQGPLR CCCCHHHHHHCCCHH | 33.20 | 22817900 | |
86 | Ubiquitination | GVVNEILQGPLRDVF CHHHHHHCCCHHHCC | 58.06 | 22817900 | |
96 | Ubiquitination | LRDVFDTKQLITDIS HHHCCCHHHHHEECC | 44.97 | 21906983 | |
105 | Phosphorylation | LITDISGSGNNWAVG HHEECCCCCCCCCHH | 31.40 | 25332170 | |
114 | Ubiquitination | NNWAVGHKVFGSLYQ CCCCHHHHHHHHHHH | 33.07 | 22817900 | |
127 | Ubiquitination | YQDQILEKFRKSAEH HHHHHHHHHHHHHHC | 47.20 | 22817900 | |
130 | Ubiquitination | QILEKFRKSAEHCDC HHHHHHHHHHHCCCH | 58.09 | 22817900 | |
173 | Ubiquitination | EFPEVYRFVTSIYPS CCHHHHHHHHCCCCC | 3.73 | 27667366 | |
204 | Ubiquitination | KELNEHADCVLPIDN HHHHHCCCEEEEECC | 25.60 | 27667366 | |
229 | Ubiquitination | DLMVNSGKLGTTVKP HHHHCCCCCCCCCCC | 43.49 | - | |
229 | Acetylation | DLMVNSGKLGTTVKP HHHHCCCCCCCCCCC | 43.49 | 25953088 | |
235 | Ubiquitination | GKLGTTVKPKSLVTS CCCCCCCCCHHHCCC | 44.64 | - | |
241 | Phosphorylation | VKPKSLVTSSSGALK CCCHHHCCCCCCHHH | 28.34 | - | |
243 | Phosphorylation | PKSLVTSSSGALKKQ CHHHCCCCCCHHHHH | 24.35 | 25627689 | |
248 | Ubiquitination | TSSSGALKKQHKKPF CCCCCHHHHHCCCHH | 50.26 | 27667366 | |
249 | Ubiquitination | SSSGALKKQHKKPFD CCCCHHHHHCCCHHH | 59.49 | - | |
254 | Ubiquitination | LKKQHKKPFDAMNNI HHHHCCCHHHHHHHH | 36.83 | 23503661 | |
264 | Ubiquitination | AMNNIVANLLLNLTS HHHHHHHHHHHHHHC | 21.96 | 23503661 | |
285 | Ubiquitination | SLNMDLNEISMNLVP CCCCCHHHHHHHCCC | 43.68 | 23503661 | |
295 | Ubiquitination | MNLVPFPQLHYLVSS HHCCCHHHHHHHHHH | 41.05 | 23503661 | |
329 | Ubiquitination | MFSDAFSKDHQLLRA HHHHHCCCCCHHHHC | 53.42 | 23503661 | |
339 | Ubiquitination | QLLRADPKHSLYLAC HHHHCCCCHHHHHHH | 46.50 | 23503661 | |
357 | Phosphorylation | VRGNVQISDLRRNIE HCCCCCHHHHHHHHH | 17.32 | 24719451 | |
367 | Ubiquitination | RRNIERLKPSLQFVS HHHHHHHCCCEEEEE | 38.49 | - | |
472 | Phosphorylation | VQDLPRLSIAM---- HHHCCCCCCCC---- | 15.02 | 28555341 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBE_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBE_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBE_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TBD_HUMAN | TUBD1 | physical | 28514442 | |
CP059_HUMAN | C16orf59 | physical | 28514442 | |
CN080_HUMAN | C14orf80 | physical | 28514442 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00570 | Vinblastine |
loading...