UniProt ID | BORC5_HUMAN | |
---|---|---|
UniProt AC | Q969J3 | |
Protein Name | BLOC-1-related complex subunit 5 {ECO:0000305} | |
Gene Name | BORCS5 {ECO:0000312|HGNC:HGNC:17950} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 196 | |
Subcellular Localization |
Lysosome membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. Thereby, it may indirectly play a role in cell spreading and motility.. | |
Protein Sequence | MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGSEQSSEA ------CCCCCCCCC | 25807930 | ||
6 | Phosphorylation | --MGSEQSSEAESRP --CCCCCCCCCCCCC | - | ||
18 | Phosphorylation | SRPNDLNSSVTPSPA CCCCCCCCCCCCCHH | 22199227 | ||
19 | Phosphorylation | RPNDLNSSVTPSPAK CCCCCCCCCCCCHHH | 27732954 | ||
21 | Phosphorylation | NDLNSSVTPSPAKHR CCCCCCCCCCHHHHH | 27732954 | ||
23 | Phosphorylation | LNSSVTPSPAKHRAK CCCCCCCCHHHHHCC | 22199227 | ||
30 | Ubiquitination | SPAKHRAKMDDIVVV CHHHHHCCCCCEEEE | - | ||
48 | Phosphorylation | SQASRNVSNDPDVIK CHHHCCCCCCCCCCH | 27499020 | ||
67 | Ubiquitination | PTFQPLLKGLLSGQT CCHHHHHHHHHCCCC | - | ||
71 | Phosphorylation | PLLKGLLSGQTSPTN HHHHHHHCCCCCCCC | 30266825 | ||
74 | Phosphorylation | KGLLSGQTSPTNAKL HHHHCCCCCCCCHHH | 30266825 | ||
75 | Phosphorylation | GLLSGQTSPTNAKLE HHHCCCCCCCCHHHH | 25159151 | ||
77 | Phosphorylation | LSGQTSPTNAKLEKL HCCCCCCCCHHHHHC | 30266825 | ||
80 | Ubiquitination | QTSPTNAKLEKLDSQ CCCCCCHHHHHCCHH | - | ||
161 | Sulfoxidation | AILRRIQMGIDQTVP HHHHHHHHCCCCHHH | 21406390 | ||
175 | Phosphorylation | PLLDRLNSMLPEGER HHHHHHHHCCCCCCC | 23917254 | ||
187 | Phosphorylation | GERLEPFSMKPDREL CCCCCCCCCCCCCCC | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BORC5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
2 | G | Myristoylation |
| 25807930 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BORC5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BORC5_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...