UniProt ID | FGF3_HUMAN | |
---|---|---|
UniProt AC | P11487 | |
Protein Name | Fibroblast growth factor 3 | |
Gene Name | FGF3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 239 | |
Subcellular Localization | Secreted . | |
Protein Description | Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal ear development.. | |
Protein Sequence | MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | Methylation | LRRDAGGRGGVYEHL CCCCCCCCCCHHHHC | 37.46 | - | |
44 | Methylation | EHLGGAPRRRKLYCA HHCCCCCCCCCEEEE | 50.96 | - | |
45 | Methylation | HLGGAPRRRKLYCAT HCCCCCCCCCEEEEE | 38.74 | - | |
49 | Phosphorylation | APRRRKLYCATKYHL CCCCCCEEEEEEEEE | 5.31 | 22210691 | |
52 | Phosphorylation | RRKLYCATKYHLQLH CCCEEEEEEEEEEEC | 28.68 | 22210691 | |
65 | N-linked_Glycosylation | LHPSGRVNGSLENSA ECCCCCCCCCCCCCC | 32.73 | UniProtKB CARBOHYD | |
93 | Phosphorylation | VAIRGLFSGRYLAMN EEEEHHHHCCEEEEC | 27.66 | 22673903 | |
96 | Phosphorylation | RGLFSGRYLAMNKRG EHHHHCCEEEECCCC | 11.44 | 22673903 | |
136 | Phosphorylation | YASRLYRTVSSTPGA HHHHHHHHHCCCCCC | 15.93 | - | |
138 | Phosphorylation | SRLYRTVSSTPGARR HHHHHHHCCCCCCCC | 28.07 | - | |
139 | Phosphorylation | RLYRTVSSTPGARRQ HHHHHHCCCCCCCCC | 33.99 | - | |
176 | Phosphorylation | TRRTQKSSLFLPRVL CCCCCCCCCCHHHHH | 30.12 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FGF3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FGF3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FGF3_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...