dbPTM

RCC1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RCC1_MOUSE
UniProt AC	Q8VE37
Protein Name	Regulator of chromosome condensation
Gene Name	Rcc1
Organism	Mus musculus (Mouse).
Sequence Length	421
Subcellular Localization	Nucleus . Chromosome . Cytoplasm . Predominantly nuclear in interphase cells. Binds to mitotic chromosomes.
Protein Description	Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP, and thereby plays an important role in RAN-mediated functions in nuclear import and mitosis. Contributes to the generation of high levels of chromosome-associated, GTP-bound RAN, which is important for mitotic spindle assembly and normal progress through mitosis. Via its role in maintaining high levels of GTP-bound RAN in the nucleus, contributes to the release of cargo proteins from importins after nuclear import. Involved in the regulation of onset of chromosome condensation in the S phase. Binds both to the nucleosomes and double-stranded DNA..
Protein Sequence	MPPKRIAKRRSPPEDAIPKSKKVKVSHRSHNTEPGLVLTLGQGDVGQLGLGESVLERKKPALVPLLQDVVQAEAGGMHTVCLSQSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDAPVVKVASGNDHLVMLTNDGDLYTLGCGEQGQLGRVPELFANRGGRQGLGRLLVPRCVLLKSRGTRGRVRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTPGTGSCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPVVSSVACGASVGYAVSKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMTGKQLENRVVLTVSSGGQHTVLLVKDQAQS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Methylation	------MPPKRIAKR ------CCHHHHCCC	43.02	20668449
11	Phosphorylation	KRIAKRRSPPEDAIP HHHCCCCCCCHHCCC	49.17	26824392
29	Phosphorylation	KVKVSHRSHNTEPGL CEEEECCCCCCCCCE	18.70	22705319
32	Phosphorylation	VSHRSHNTEPGLVLT EECCCCCCCCCEEEE	37.83	22705319
103	Phosphorylation	EGALGRDTSVEGSEM CCCCCCCCCCCCCCC	33.05	28066266
104	Phosphorylation	GALGRDTSVEGSEMV CCCCCCCCCCCCCCC	23.59	28066266
214	Methylation	VPELFANRGGRQGLG CCHHHCCCCCCCCCH	45.58	30989211
403	Phosphorylation	LENRVVLTVSSGGQH ECCEEEEEEECCCEE	13.51	19854140
411	Phosphorylation	VSSGGQHTVLLVKDQ EECCCEEEEEEEECC	12.64	19854140

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RCC1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RCC1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RCC1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RED2_HUMAN	ADARB2	physical	26496610
DECR_HUMAN	DECR1	physical	26496610
FLII_HUMAN	FLII	physical	26496610
H33_HUMAN	H3F3A	physical	26496610
IMB1_HUMAN	KPNB1	physical	26496610
IMA1_HUMAN	KPNA2	physical	26496610
IMA4_HUMAN	KPNA3	physical	26496610
IMA3_HUMAN	KPNA4	physical	26496610
AFF1_HUMAN	AFF1	physical	26496610
NEUR1_HUMAN	NEU1	physical	26496610
NUP88_HUMAN	NUP88	physical	26496610
NUP98_HUMAN	NUP98	physical	26496610
RAD51_HUMAN	RAD51	physical	26496610
RAN_HUMAN	RAN	physical	26496610
RANG_HUMAN	RANBP1	physical	26496610
RBP2_HUMAN	RANBP2	physical	26496610
RAGP1_HUMAN	RANGAP1	physical	26496610
KDM5A_HUMAN	KDM5A	physical	26496610
RS2_HUMAN	RPS2	physical	26496610
SUMO2_HUMAN	SUMO2	physical	26496610
TBB2A_HUMAN	TUBB2A	physical	26496610
UBC9_HUMAN	UBE2I	physical	26496610
SUMO1_HUMAN	SUMO1	physical	26496610
XPO1_HUMAN	XPO1	physical	26496610
R113A_HUMAN	RNF113A	physical	26496610
NU214_HUMAN	NUP214	physical	26496610
AAAS_HUMAN	AAAS	physical	26496610
H31_HUMAN	HIST1H3A	physical	26496610
RAE1L_HUMAN	RAE1	physical	26496610
GEMI2_HUMAN	GEMIN2	physical	26496610
RB11A_HUMAN	RAB11A	physical	26496610
WDR46_HUMAN	WDR46	physical	26496610
NU155_HUMAN	NUP155	physical	26496610
NUP93_HUMAN	NUP93	physical	26496610
P121A_HUMAN	POM121	physical	26496610
NU153_HUMAN	NUP153	physical	26496610
NXF1_HUMAN	NXF1	physical	26496610
NUP50_HUMAN	NUP50	physical	26496610
HPS5_HUMAN	HPS5	physical	26496610
NU205_HUMAN	NUP205	physical	26496610
PO210_HUMAN	NUP210	physical	26496610
NU160_HUMAN	NUP160	physical	26496610
NU188_HUMAN	NUP188	physical	26496610
CHM2B_HUMAN	CHMP2B	physical	26496610
NTM1A_HUMAN	NTMT1	physical	26496610
FXL19_HUMAN	FBXL19	physical	26496610
SAMD9_HUMAN	SAMD9	physical	26496610
TM214_HUMAN	TMEM214	physical	26496610
NDC1_HUMAN	NDC1	physical	26496610
NU107_HUMAN	NUP107	physical	26496610
GPAT1_HUMAN	GPAM	physical	26496610
GATD1_HUMAN	GATAD1	physical	26496610
NUP85_HUMAN	NUP85	physical	26496610
SEH1_HUMAN	SEH1L	physical	26496610
TM209_HUMAN	TMEM209	physical	26496610
IMP4_HUMAN	IMP4	physical	26496610
NUP53_HUMAN	NUP35	physical	26496610
CDCA2_HUMAN	CDCA2	physical	26496610
R3HC1_HUMAN	R3HCC1	physical	26496610
F177A_HUMAN	FAM177A1	physical	26496610
NUP43_HUMAN	NUP43	physical	26496610
RGPD8_HUMAN	RGPD8	physical	26496610
RAN_MOUSE	Ran	physical	26304119

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RCC1_MOUSE

Related Literatures of Post-Translational Modification

Methylation
Reference	PubMed
"NRMT is an alpha-N-methyltransferase that methylates RCC1 andretinoblastoma protein."; Tooley C.E., Petkowski J.J., Muratore-Schroeder T.L., Balsbaugh J.L.,Shabanowitz J., Sabat M., Minor W., Hunt D.F., Macara I.G.; Nature 466:1125-1128(2010). Cited for: CLEAVAGE OF INITIATOR METHIONINE, AND METHYLATION AT PRO-2.	20668449 [Abstract]
Phosphorylation
Reference	PubMed
"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-11, AND MASSSPECTROMETRY.	19367708 [Abstract]