UniProt ID | GATD1_HUMAN | |
---|---|---|
UniProt AC | Q8WUU5 | |
Protein Name | GATA zinc finger domain-containing protein 1 | |
Gene Name | GATAD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 269 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of some chromatin complex recruited to chromatin sites methylated 'Lys-4' of histone H3 (H3K4me).. | |
Protein Sequence | MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGFGAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKESVANHL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Methylation | --MPLGLKPTCSVCK --CCCCCCCCCCEEE | 36.16 | 23644510 | |
6 | "N6,N6-dimethyllysine" | --MPLGLKPTCSVCK --CCCCCCCCCCEEE | 36.16 | - | |
10 | Phosphorylation | LGLKPTCSVCKTTSS CCCCCCCCEEECCCC | 32.78 | 28857561 | |
21 | "N6,N6-dimethyllysine" | TTSSSMWKKGAQGEI CCCCHHHHCCCCCEE | 32.46 | - | |
21 | Methylation | TTSSSMWKKGAQGEI CCCCHHHHCCCCCEE | 32.46 | 23644510 | |
34 | Phosphorylation | EILCHHCTGRGGAGS EEEEECCCCCCCCCC | 26.09 | 22115753 | |
41 | Phosphorylation | TGRGGAGSGGAGSGA CCCCCCCCCCCCCCC | 33.25 | 28857561 | |
46 | Phosphorylation | AGSGGAGSGAAGGTG CCCCCCCCCCCCCCC | 25.40 | 28857561 | |
52 | Phosphorylation | GSGAAGGTGGSGGGG CCCCCCCCCCCCCCC | 37.13 | 22115753 | |
55 | Phosphorylation | AAGGTGGSGGGGFGA CCCCCCCCCCCCCCC | 35.29 | 22115753 | |
64 | Phosphorylation | GGGFGAATFASTSAT CCCCCCCEEEECCCC | 21.14 | 22115753 | |
67 | Phosphorylation | FGAATFASTSATPPQ CCCCEEEECCCCCCC | 20.78 | 22115753 | |
68 | Phosphorylation | GAATFASTSATPPQS CCCEEEECCCCCCCC | 20.96 | 30576142 | |
69 | Phosphorylation | AATFASTSATPPQSN CCEEEECCCCCCCCC | 27.87 | 22115753 | |
71 | Phosphorylation | TFASTSATPPQSNGG EEEECCCCCCCCCCC | 34.96 | 28857561 | |
75 | Phosphorylation | TSATPPQSNGGGGGK CCCCCCCCCCCCCCH | 43.12 | 28857561 | |
84 | Phosphorylation | GGGGGKQSKQEIHRR CCCCCHHHHHHHHHH | 39.53 | 23403867 | |
92 | Phosphorylation | KQEIHRRSARLRNTK HHHHHHHHHHHHHCC | 20.07 | 27282143 | |
108 | Acetylation | KSAPAAEKKVSTKGK CCCCHHHHCCCCCCC | 54.47 | 7380089 | |
109 | Acetylation | SAPAAEKKVSTKGKG CCCHHHHCCCCCCCC | 32.68 | 7380099 | |
186 | Phosphorylation | CEKSAALTWLIPTLS CCHHHHHHHHCCCCC | 17.31 | 20068231 | |
191 | Phosphorylation | ALTWLIPTLSSPRDQ HHHHHCCCCCCCHHH | 32.07 | 26270265 | |
193 | Phosphorylation | TWLIPTLSSPRDQFD HHHCCCCCCCHHHCC | 40.55 | 20068231 | |
194 | Phosphorylation | WLIPTLSSPRDQFDP HHCCCCCCCHHHCCC | 27.37 | 21815630 | |
232 | Phosphorylation | APSEYFKSRSSPFPT CCHHHHHCCCCCCCC | 27.74 | 28985074 | |
234 | Phosphorylation | SEYFKSRSSPFPTVP HHHHHCCCCCCCCCC | 49.83 | 25159151 | |
235 | Phosphorylation | EYFKSRSSPFPTVPT HHHHCCCCCCCCCCC | 29.47 | 25159151 | |
239 | Phosphorylation | SRSSPFPTVPTRPEK CCCCCCCCCCCCCCC | 39.22 | 23186163 | |
248 | Phosphorylation | PTRPEKGYIWTHVGP CCCCCCCCEEEECCC | 12.35 | - | |
262 | Sumoylation | PTPAITIKESVANHL CCCCEEEHHHHHHCC | 34.97 | 28112733 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GATD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GATD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GATD1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
614672 | Cardiomyopathy, dilated 2B (CMD2B) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...