UniProt ID | HERP2_HUMAN | |
---|---|---|
UniProt AC | Q9BSE4 | |
Protein Name | Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein | |
Gene Name | HERPUD2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 406 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | Could be involved in the unfolded protein response (UPR) pathway.. | |
Protein Sequence | MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLVCTSRTPPSSPKSSTNRESHEALASSSNSSSDHSGSTTPSSGQETLSLAVGSSSEGLRQRTLPQAQTDQAQSHQFPYVMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAHQYYMQYQAAVSAQATSNVNPTQPTTSQPLNLAHVPGEEPPPAPNLVAQENRPMNENVQMNAQGGPVLNEEDFNRDWLDWMYTFSRAAILLSIVYFYSSFSRFIMVMGAMLLVYLHQAGWFPFRQEGGHQQAPNNNAEVNNDGQNANNLELEEMERLMDDGLEDESGEDGGEDASAIQRPGLMASAWSFITTFFTSLIPEGPPQVAN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | SGMEIPVTLIIKAPN CCCCCCEEEEEECCC | 13.59 | 22210691 | |
45 | Phosphorylation | KTHLSNVYPSKPLTK HHHHHHCCCCCCCCC | 13.16 | - | |
47 | Phosphorylation | HLSNVYPSKPLTKDQ HHHHCCCCCCCCCCC | 29.26 | 24719451 | |
48 | Ubiquitination | LSNVYPSKPLTKDQR HHHCCCCCCCCCCCE | 39.27 | - | |
51 | Phosphorylation | VYPSKPLTKDQRLVY CCCCCCCCCCCEEEE | 40.89 | - | |
52 | Ubiquitination | YPSKPLTKDQRLVYS CCCCCCCCCCEEEEC | 60.59 | - | |
79 | Phosphorylation | ILRKQDEYHMVHLVC HHHHCCCCEEEEEEE | 11.96 | 30108239 | |
87 | Phosphorylation | HMVHLVCTSRTPPSS EEEEEEEECCCCCCC | 17.48 | 30108239 | |
88 | Phosphorylation | MVHLVCTSRTPPSSP EEEEEEECCCCCCCC | 29.09 | 30108239 | |
90 | Phosphorylation | HLVCTSRTPPSSPKS EEEEECCCCCCCCCC | 39.04 | 23927012 | |
93 | Phosphorylation | CTSRTPPSSPKSSTN EECCCCCCCCCCCCC | 61.55 | 30576142 | |
94 | Phosphorylation | TSRTPPSSPKSSTNR ECCCCCCCCCCCCCH | 41.96 | 30108239 | |
97 | Phosphorylation | TPPSSPKSSTNRESH CCCCCCCCCCCHHHH | 45.86 | 26074081 | |
98 | Phosphorylation | PPSSPKSSTNRESHE CCCCCCCCCCHHHHH | 35.51 | 26074081 | |
99 | Phosphorylation | PSSPKSSTNRESHEA CCCCCCCCCHHHHHH | 45.44 | 26074081 | |
137 | Phosphorylation | LSLAVGSSSEGLRQR EEEEEECCCHHHHHC | 26.87 | 24275569 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HERP2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HERP2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HERP2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HERP2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...