UniProt ID | PDGFB_HUMAN | |
---|---|---|
UniProt AC | P01127 | |
Protein Name | Platelet-derived growth factor subunit B | |
Gene Name | PDGFB | |
Organism | Homo sapiens (Human). | |
Sequence Length | 241 | |
Subcellular Localization | Secreted. Released by platelets upon wounding. | |
Protein Description | Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. [PubMed: 26599395 Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA (By similarity] | |
Protein Sequence | MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
63 | N-linked_Glycosylation | DGAELDLNMTRSHSG CCCEECCEEECCCCC | 29.46 | UniProtKB CARBOHYD | |
67 | Phosphorylation | LDLNMTRSHSGGELE ECCEEECCCCCHHHH | 16.91 | 28348404 | |
69 | Phosphorylation | LNMTRSHSGGELESL CEEECCCCCHHHHHH | 50.14 | 28348404 | |
99 | Phosphorylation | AMIAECKTRTEVFEI HHEEECCCHHHHHHH | 55.25 | 28509920 | |
190 | Phosphorylation | VAAARPVTRSPGGSQ EEECCCCCCCCCCCH | 28.28 | - | |
190 | O-linked_Glycosylation | VAAARPVTRSPGGSQ EEECCCCCCCCCCCH | 28.28 | 37009957 | |
196 | Phosphorylation | VTRSPGGSQEQRAKT CCCCCCCCHHHHCCC | 36.14 | 24275569 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PDGFB_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PDGFB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PDGFB_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...