| UniProt ID | UTP23_HUMAN | |
|---|---|---|
| UniProt AC | Q9BRU9 | |
| Protein Name | rRNA-processing protein UTP23 homolog | |
| Gene Name | UTP23 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 249 | |
| Subcellular Localization | Nucleus, nucleolus. | |
| Protein Description | Involved in rRNA-processing and ribosome biogenesis.. | |
| Protein Sequence | MKITRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKELETLGKDLYGAKLIAQKCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVATQDQNLSVKVKKKPGVPLMFIIQNTMVLDKPSPKTIAFVKAVESGQLVSVHEKESIKHLKEEQGLVKNTEQSRRKKRKKISGPNPLSCLKKKKKAPDTQSSASEKKRKRKRIRNRSNPKVLSEKQNAEGE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 67 | Acetylation | CTTRCVLKELETLGK HHHHHHHHHHHHHCC | 39.60 | 26051181 | |
| 74 | Ubiquitination | KELETLGKDLYGAKL HHHHHHCCHHHHHHH | 47.90 | 29967540 | |
| 74 | Acetylation | KELETLGKDLYGAKL HHHHHHCCHHHHHHH | 47.90 | 23236377 | |
| 80 | Acetylation | GKDLYGAKLIAQKCQ CCHHHHHHHHHHHCC | 35.74 | 26822725 | |
| 85 | Acetylation | GAKLIAQKCQVRNCP HHHHHHHHCCCCCCC | 20.01 | 25953088 | |
| 85 | Ubiquitination | GAKLIAQKCQVRNCP HHHHHHHHCCCCCCC | 20.01 | 32015554 | |
| 168 | Phosphorylation | VESGQLVSVHEKESI EHHCCEEEEECHHHH | 26.75 | 28122231 | |
| 174 | Phosphorylation | VSVHEKESIKHLKEE EEEECHHHHHHHHHH | 48.26 | 25159151 | |
| 179 | Sumoylation | KESIKHLKEEQGLVK HHHHHHHHHHCCCCC | 59.95 | 28112733 | |
| 179 | Sumoylation | KESIKHLKEEQGLVK HHHHHHHHHHCCCCC | 59.95 | - | |
| 186 | Ubiquitination | KEEQGLVKNTEQSRR HHHCCCCCCHHHHHH | 64.29 | 33845483 | |
| 200 | Phosphorylation | RKKRKKISGPNPLSC HHHHHCCCCCCHHHH | 58.01 | 25159151 | |
| 206 | Phosphorylation | ISGPNPLSCLKKKKK CCCCCHHHHHHHCCC | 20.75 | 25159151 | |
| 217 | Phosphorylation | KKKKAPDTQSSASEK HCCCCCCCCCCHHHH | 29.32 | 29396449 | |
| 219 | Phosphorylation | KKAPDTQSSASEKKR CCCCCCCCCHHHHHH | 29.93 | 29396449 | |
| 220 | Phosphorylation | KAPDTQSSASEKKRK CCCCCCCCHHHHHHH | 26.46 | 29396449 | |
| 222 | Phosphorylation | PDTQSSASEKKRKRK CCCCCCHHHHHHHHH | 52.47 | 28985074 | |
| 235 | Phosphorylation | RKRIRNRSNPKVLSE HHHHHHCCCHHHHCH | 62.12 | 21712546 | |
| 238 | Ubiquitination | IRNRSNPKVLSEKQN HHHCCCHHHHCHHCC | 61.12 | 22817900 | |
| 241 | Phosphorylation | RSNPKVLSEKQNAEG CCCHHHHCHHCCCCC | 45.82 | 26055452 | |
| 243 (in isoform 1) | Ubiquitination | - | 45.54 | 21906983 | |
| 243 | Acetylation | NPKVLSEKQNAEGE- CHHHHCHHCCCCCC- | 45.54 | 26051181 | |
| 243 | Ubiquitination | NPKVLSEKQNAEGE- CHHHHCHHCCCCCC- | 45.54 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UTP23_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UTP23_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UTP23_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| K1C40_HUMAN | KRT40 | physical | 25416956 | |
| KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
| KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
| NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
| RRS1_HUMAN | RRS1 | physical | 26344197 | |
| FCF1_HUMAN | FCF1 | physical | 28082392 | |
| RRP7A_HUMAN | RRP7A | physical | 28082392 | |
| NHP2_HUMAN | NHP2 | physical | 28082392 | |
| DDX52_HUMAN | DDX52 | physical | 28082392 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...