UniProt ID | UTP23_HUMAN | |
---|---|---|
UniProt AC | Q9BRU9 | |
Protein Name | rRNA-processing protein UTP23 homolog | |
Gene Name | UTP23 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 249 | |
Subcellular Localization | Nucleus, nucleolus. | |
Protein Description | Involved in rRNA-processing and ribosome biogenesis.. | |
Protein Sequence | MKITRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKELETLGKDLYGAKLIAQKCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVATQDQNLSVKVKKKPGVPLMFIIQNTMVLDKPSPKTIAFVKAVESGQLVSVHEKESIKHLKEEQGLVKNTEQSRRKKRKKISGPNPLSCLKKKKKAPDTQSSASEKKRKRKRIRNRSNPKVLSEKQNAEGE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
67 | Acetylation | CTTRCVLKELETLGK HHHHHHHHHHHHHCC | 39.60 | 26051181 | |
74 | Ubiquitination | KELETLGKDLYGAKL HHHHHHCCHHHHHHH | 47.90 | 29967540 | |
74 | Acetylation | KELETLGKDLYGAKL HHHHHHCCHHHHHHH | 47.90 | 23236377 | |
80 | Acetylation | GKDLYGAKLIAQKCQ CCHHHHHHHHHHHCC | 35.74 | 26822725 | |
85 | Acetylation | GAKLIAQKCQVRNCP HHHHHHHHCCCCCCC | 20.01 | 25953088 | |
85 | Ubiquitination | GAKLIAQKCQVRNCP HHHHHHHHCCCCCCC | 20.01 | 32015554 | |
168 | Phosphorylation | VESGQLVSVHEKESI EHHCCEEEEECHHHH | 26.75 | 28122231 | |
174 | Phosphorylation | VSVHEKESIKHLKEE EEEECHHHHHHHHHH | 48.26 | 25159151 | |
179 | Sumoylation | KESIKHLKEEQGLVK HHHHHHHHHHCCCCC | 59.95 | 28112733 | |
179 | Sumoylation | KESIKHLKEEQGLVK HHHHHHHHHHCCCCC | 59.95 | - | |
186 | Ubiquitination | KEEQGLVKNTEQSRR HHHCCCCCCHHHHHH | 64.29 | 33845483 | |
200 | Phosphorylation | RKKRKKISGPNPLSC HHHHHCCCCCCHHHH | 58.01 | 25159151 | |
206 | Phosphorylation | ISGPNPLSCLKKKKK CCCCCHHHHHHHCCC | 20.75 | 25159151 | |
217 | Phosphorylation | KKKKAPDTQSSASEK HCCCCCCCCCCHHHH | 29.32 | 29396449 | |
219 | Phosphorylation | KKAPDTQSSASEKKR CCCCCCCCCHHHHHH | 29.93 | 29396449 | |
220 | Phosphorylation | KAPDTQSSASEKKRK CCCCCCCCHHHHHHH | 26.46 | 29396449 | |
222 | Phosphorylation | PDTQSSASEKKRKRK CCCCCCHHHHHHHHH | 52.47 | 28985074 | |
235 | Phosphorylation | RKRIRNRSNPKVLSE HHHHHHCCCHHHHCH | 62.12 | 21712546 | |
238 | Ubiquitination | IRNRSNPKVLSEKQN HHHCCCHHHHCHHCC | 61.12 | 22817900 | |
241 | Phosphorylation | RSNPKVLSEKQNAEG CCCHHHHCHHCCCCC | 45.82 | 26055452 | |
243 (in isoform 1) | Ubiquitination | - | 45.54 | 21906983 | |
243 | Acetylation | NPKVLSEKQNAEGE- CHHHHCHHCCCCCC- | 45.54 | 26051181 | |
243 | Ubiquitination | NPKVLSEKQNAEGE- CHHHHCHHCCCCCC- | 45.54 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UTP23_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UTP23_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UTP23_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
K1C40_HUMAN | KRT40 | physical | 25416956 | |
KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
RRS1_HUMAN | RRS1 | physical | 26344197 | |
FCF1_HUMAN | FCF1 | physical | 28082392 | |
RRP7A_HUMAN | RRP7A | physical | 28082392 | |
NHP2_HUMAN | NHP2 | physical | 28082392 | |
DDX52_HUMAN | DDX52 | physical | 28082392 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...