| UniProt ID | TNR5_HUMAN | |
|---|---|---|
| UniProt AC | P25942 | |
| Protein Name | Tumor necrosis factor receptor superfamily member 5 | |
| Gene Name | CD40 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 277 | |
| Subcellular Localization |
Isoform I: Cell membrane Single-pass type I membrane protein. Isoform II: Secreted. |
|
| Protein Description | Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.. | |
| Protein Sequence | MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 153 | N-linked_Glycosylation | CPVGFFSNVSSAFEK CCCCCCCCCHHHHHH | 32.31 | UniProtKB CARBOHYD | |
| 156 | Phosphorylation | GFFSNVSSAFEKCHP CCCCCCHHHHHHHCC | 32.47 | 24719451 | |
| 180 | N-linked_Glycosylation | VVQQAGTNKTDVVCG EEEECCCCCCCCEEC | 44.29 | 17660510 | |
| 223 | Phosphorylation | KKVAKKPTNKAPHPK HHHHCCCCCCCCCCC | 59.22 | - | |
| 254 | Phosphorylation | TAAPVQETLHGCQPV CCCCHHHHHCCCEEE | 13.63 | 22817900 | |
| 269 | Phosphorylation | TQEDGKESRISVQER CCCCCCCCCCCCCCC | 38.10 | 28060719 | |
| 272 | Phosphorylation | DGKESRISVQERQ-- CCCCCCCCCCCCC-- | 19.35 | 28355574 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TNR5_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TNR5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TNR5_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| H00086 | Hyper IgM syndromes, autosomal recessive type, including the following three diseases: Activation-in | |||||
| H00093 | Combined immunodeficiencies (CIDs), including the following nine diseases: X-linked hyper IgM syndro | |||||
| OMIM Disease | ||||||
| 606843 | Immunodeficiency with hyper-IgM 3 (HIGM3) | |||||
| Kegg Drug | ||||||
| D06071 | Teneliximab (USAN/INN) | |||||
| D08896 | Dacetuzumab (USAN) | |||||
| D08942 | Lucatumumab (USAN) | |||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
