UniProt ID | DUS19_HUMAN | |
---|---|---|
UniProt AC | Q8WTR2 | |
Protein Name | Dual specificity protein phosphatase 19 | |
Gene Name | DUSP19 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 217 | |
Subcellular Localization | ||
Protein Description | Has a dual specificity toward Ser/Thr and Tyr-containing proteins.. | |
Protein Sequence | MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MYSLNQEI -------CCCCHHHH | 4.65 | 22814378 | |
2 | Phosphorylation | ------MYSLNQEIK ------CCCCHHHHH | 23.12 | 19664995 | |
21 | Phosphorylation | NNLRKQCTRVTTLTG CCHHHHCCEEEECCC | 26.19 | 29083192 | |
24 | Phosphorylation | RKQCTRVTTLTGKKI HHHCCEEEECCCHHH | 16.88 | 29083192 | |
25 | Phosphorylation | KQCTRVTTLTGKKII HHCCEEEECCCHHHH | 21.33 | 29083192 | |
27 | Phosphorylation | CTRVTTLTGKKIIET CCEEEECCCHHHHHH | 44.88 | 29083192 | |
34 | O-linked_Glycosylation | TGKKIIETWKDARIH CCHHHHHHHHCCCEE | 27.66 | 30379171 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DUS19_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DUS19_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DUS19_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...