ES1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ES1_HUMAN
• UniProt AC: P30042
• Protein Name: ES1 protein homolog, mitochondrial
• Gene Name: C21orf33
• Organism: Homo sapiens (Human).
• Sequence Length: 268
• Subcellular Localization: Mitochondrion .
• Protein Sequence: MAAVRVLVASRLAAASAFTSLSPGGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
116	Acetylation	SARIARGKITDLANL HHHHHHCCHHHHHHH	36.56	25038526
116 (in isoform 2)	Ubiquitination	-	36.56	21890473
116 (in isoform 1)	Ubiquitination	-	36.56	21890473
141	Acetylation	PGGFGAAKNLSTFAV CCCCCCCCCCCEEEE	58.86	25038526
141 (in isoform 1)	Ubiquitination	-	58.86	21890473
151	Acetylation	STFAVDGKDCKVNKE CEEEECCCCCCCCHH	56.33	25038526
151	Malonylation	STFAVDGKDCKVNKE CEEEECCCCCCCCHH	56.33	26320211
153	S-palmitoylation	FAVDGKDCKVNKEVE EEECCCCCCCCHHHH	6.37	21044946
157	Acetylation	GKDCKVNKEVERVLK CCCCCCCHHHHHHHH	67.15	26051181
157	Succinylation	GKDCKVNKEVERVLK CCCCCCCHHHHHHHH	67.15	23954790
164	Succinylation	KEVERVLKEFHQAGK HHHHHHHHHHHHCCC	56.32	27452117
171	Acetylation	KEFHQAGKPIGLCCI HHHHHCCCCEEEECH	36.16	26051181
176	S-nitrosylation	AGKPIGLCCIAPVLA CCCCEEEECHHHHHH	1.01	19483679
177	S-nitrosylation	GKPIGLCCIAPVLAA CCCEEEECHHHHHHH	3.41	19483679
185 (in isoform 1)	Ubiquitination	-	35.87	21890473
203	Malonylation	HEQEEGGKWPYAGTA CCCCCCCCCCCCCHH	56.72	26320211
203	Acetylation	HEQEEGGKWPYAGTA CCCCCCCCCCCCCHH	56.72	23954790
214	Acetylation	AGTAEAIKALGAKHC CCHHHHHHHHCCHHH	44.60	25038526
219	Succinylation	AIKALGAKHCVKEVV HHHHHCCHHHHHHHH	35.42	27452117
219	Acetylation	AIKALGAKHCVKEVV HHHHHCCHHHHHHHH	35.42	25953088
223	Acetylation	LGAKHCVKEVVEAHV HCCHHHHHHHHHHHH	50.62	25038526
223	Succinylation	LGAKHCVKEVVEAHV HCCHHHHHHHHHHHH	50.62	23954790
233	Acetylation	VEAHVDQKNKVVTTP HHHHHHCCCCEEEEH	55.03	25038526
233	Succinylation	VEAHVDQKNKVVTTP HHHHHHCCCCEEEEH	55.03	27452117
261	Acetylation	GIGAMVRKVLELTGK CHHHHHHHHHHHHCC	39.50	23749302
261	Malonylation	GIGAMVRKVLELTGK CHHHHHHHHHHHHCC	39.50	26320211
268	Acetylation	KVLELTGK------- HHHHHHCC-------	52.51	7672211

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ES1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ES1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ES1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
GLSK_HUMAN	GLS	physical	26186194
FMT_HUMAN	MTFMT	physical	27499296
PREP_HUMAN	PITRM1	physical	27499296
ATP5E_HUMAN	ATP5E	physical	27499296
RM22_HUMAN	MRPL22	physical	27499296
C1QBP_HUMAN	C1QBP	physical	27499296
ECH1_HUMAN	ECH1	physical	27499296

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Acetylation

"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-164, AND MASS SPECTROMETRY.
PubMed: 19608861