| UniProt ID | DYR2_HUMAN | |
|---|---|---|
| UniProt AC | Q86XF0 | |
| Protein Name | Dihydrofolate reductase 2, mitochondrial | |
| Gene Name | DHFR2 {ECO:0000312|HGNC:HGNC:27309} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 187 | |
| Subcellular Localization | Mitochondrion . Mitochondrion matrix . Mitochondrion inner membrane . | |
| Protein Description | Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Binds its own mRNA and that of DHFR.. | |
| Protein Sequence | MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 19 | Acetylation | SQNMGIGKNGDLPRP HHHCCCCCCCCCCCC | 25953088 | ||
| 33 | Methylation | PPLRNEFRYFQRMTT CCCCCHHHHEEECCC | - | ||
| 39 | Phosphorylation | FRYFQRMTTTSSVEG HHHEEECCCCCCCCC | 20068231 | ||
| 47 | Ubiquitination | TTSSVEGKQNLVIMG CCCCCCCCEEEEEEC | 27667366 | ||
| 56 | Ubiquitination | NLVIMGRKTWFSIPE EEEEECCEEEEECCC | 29967540 | ||
| 64 | Ubiquitination | TWFSIPEKNRPLKDR EEEECCCCCCCHHHH | 32015554 | ||
| 69 | Ubiquitination | PEKNRPLKDRINLVL CCCCCCHHHHHHHHH | - | ||
| 77 | Phosphorylation | DRINLVLSRELKEPP HHHHHHHCHHCCCCC | 24719451 | ||
| 81 | Ubiquitination | LVLSRELKEPPQGAH HHHCHHCCCCCCHHH | 27667366 | ||
| 93 | Phosphorylation | GAHFLARSLDDALKL HHHHHHHCHHHHHHH | 20860994 | ||
| 137 | Phosphorylation | GHLKLFVTRIMQDFE HHHHHHHHHHHHHHC | - | ||
| 156 | Ubiquitination | FSEIDLEKYKLLPEY CCCCCHHHHCCCCCC | 23503661 | ||
| 157 | Phosphorylation | SEIDLEKYKLLPEYP CCCCHHHHCCCCCCC | 18083107 | ||
| 158 | Ubiquitination | EIDLEKYKLLPEYPG CCCHHHHCCCCCCCC | 23503661 | ||
| 163 | Phosphorylation | KYKLLPEYPGVLSDV HHCCCCCCCCCCCCC | 18083107 | ||
| 179 | Ubiquitination | EGKHIKYKFEVCEKD CCCCEEEEEEEEECC | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DYR2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DYR2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DYR2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of DYR2_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
