| UniProt ID | DNS2B_HUMAN | |
|---|---|---|
| UniProt AC | Q8WZ79 | |
| Protein Name | Deoxyribonuclease-2-beta | |
| Gene Name | DNASE2B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 361 | |
| Subcellular Localization | Lysosome . | |
| Protein Description | Hydrolyzes DNA under acidic conditions. Does not require divalent cations for activity. Participates in the degradation of nuclear DNA during lens cell differentiation.. | |
| Protein Sequence | MKQKMMARLLRTSFALLFLGLFGVLGAATISCRNEEGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTTRSWRKSEQLMNDTKSVLGRTLQQLYEAYASKSNNTAYLIYNDGVPKPVNYSRKYGHTKGLLLWNRVQGFWLIHSIPQFPPIPEEGYDYPPTGRRNGQSGICITFKYNQYEAIDSQLLVCNPNVYSCSIPATFHQELIHMPQLCTRASSSEIPGRLLTTLQSAQGQKFLHFAKSDSFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 81 | N-linked_Glycosylation | RKSEQLMNDTKSVLG HHHHHHHHHHHHHHH | 63.49 | UniProtKB CARBOHYD | |
| 90 | Phosphorylation | TKSVLGRTLQQLYEA HHHHHHHHHHHHHHH | 27.41 | 25002506 | |
| 95 | Phosphorylation | GRTLQQLYEAYASKS HHHHHHHHHHHHCCC | 8.32 | 25002506 | |
| 98 | Phosphorylation | LQQLYEAYASKSNNT HHHHHHHHHCCCCCE | 10.24 | 25002506 | |
| 100 | Phosphorylation | QLYEAYASKSNNTAY HHHHHHHCCCCCEEE | 24.76 | 25002506 | |
| 102 | Phosphorylation | YEAYASKSNNTAYLI HHHHHCCCCCEEEEE | 32.58 | 25002506 | |
| 103 | N-linked_Glycosylation | EAYASKSNNTAYLIY HHHHCCCCCEEEEEE | 54.32 | UniProtKB CARBOHYD | |
| 105 | Phosphorylation | YASKSNNTAYLIYND HHCCCCCEEEEEEEC | 22.41 | 25002506 | |
| 107 | Phosphorylation | SKSNNTAYLIYNDGV CCCCCEEEEEEECCC | 7.50 | 25002506 | |
| 110 | Phosphorylation | NNTAYLIYNDGVPKP CCEEEEEEECCCCCC | 12.47 | 25002506 | |
| 119 | N-linked_Glycosylation | DGVPKPVNYSRKYGH CCCCCCCCCHHHCCC | 37.27 | UniProtKB CARBOHYD | |
| 120 | Phosphorylation | GVPKPVNYSRKYGHT CCCCCCCCHHHCCCC | 15.30 | 25002506 | |
| 121 | Phosphorylation | VPKPVNYSRKYGHTK CCCCCCCHHHCCCCH | 19.66 | 25002506 | |
| 173 | Phosphorylation | GQSGICITFKYNQYE CCCCEEEEEECCCEE | 15.06 | - | |
| 214 | Phosphorylation | IHMPQLCTRASSSEI HCHHHHHHCCCCCCC | 37.55 | - | |
| 217 | Phosphorylation | PQLCTRASSSEIPGR HHHHHCCCCCCCCHH | 30.98 | - | |
| 278 | N-linked_Glycosylation | KRQELPSNCSLPYHV HHHHCCCCCCCCEEE | 19.91 | UniProtKB CARBOHYD | |
| 283 | Phosphorylation | PSNCSLPYHVYNIKA CCCCCCCEEEEEEEE | 14.82 | 22817900 | |
| 286 | Phosphorylation | CSLPYHVYNIKAIKL CCCCEEEEEEEEEEE | 9.62 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DNS2B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DNS2B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DNS2B_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
