UniProt ID | S39A9_HUMAN | |
---|---|---|
UniProt AC | Q9NUM3 | |
Protein Name | Zinc transporter ZIP9 | |
Gene Name | SLC39A9 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 307 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | May act as a zinc-influx transporter.. | |
Protein Sequence | MDDFISISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVHALYEDILEGKHHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVFVAIMLHKAPAAFGLVSFLMHAGLERNRIRKHLLVFALAAPVMSMVTYLGLSKSSKEALSEVNATGVAMLFSAGTFLYVATVHVLPEVGGIGHSHKPDATGGRGLSRLEVAALVLGCLIPLILSVGHQH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | N-linked_Glycosylation | GIIPLAVNFSEERLK CHHHHHCCCCHHHHH | 29.17 | UniProtKB CARBOHYD | |
77 | O-linked_Glycosylation | KHHQASETHNVIASD CCCCCCCCCCCCCCC | 19.09 | OGP | |
85 | Ubiquitination | HNVIASDKAAEKSVV CCCCCCCHHHHHHCC | 47.18 | - | |
85 | 2-Hydroxyisobutyrylation | HNVIASDKAAEKSVV CCCCCCCHHHHHHCC | 47.18 | - | |
241 | N-linked_Glycosylation | KEALSEVNATGVAML HHHHHHCCHHHHHHH | 27.94 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S39A9_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S39A9_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S39A9_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...