UniProt ID | SNG3_HUMAN | |
---|---|---|
UniProt AC | O43761 | |
Protein Name | Synaptogyrin-3 {ECO:0000305} | |
Gene Name | SYNGR3 {ECO:0000312|HGNC:HGNC:11501} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 229 | |
Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Multi-pass membrane protein . Cell junction, synapse . Found at the neuromuscular synapses. |
|
Protein Description | May play a role in regulated exocytosis. May indirectly regulate the activity of the plasma membrane dopamine transporter SLC6A3 and thereby regulate dopamine transport back from the synaptic cleft into the presynaptic terminal.. | |
Protein Sequence | MEGASFGAGRAGAALDPVSFARRPQTLLRVASWVFSIAVFGPIVNEGYVNTDSGPELRCVFNGNAGACRFGVALGLGAFLACAAFLLLDVRFQQISSVRDRRRAVLLDLGFSGLWSFLWFVGFCFLTNQWQRTAPGPATTQAGDAARAAIAFSFFSILSWVALTVKALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQVPAY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEGASFGA -------CCCCCCCC | 10.93 | 22223895 | |
19 | Phosphorylation | GAALDPVSFARRPQT CCCCCHHHHCCCHHH | 20.69 | 24076635 | |
96 | Phosphorylation | DVRFQQISSVRDRRR HHHHHHHHCHHHHHH | 20.60 | 24719451 | |
139 | Phosphorylation | RTAPGPATTQAGDAA HCCCCCCCCHHHHHH | 23.68 | 25332170 | |
140 | Phosphorylation | TAPGPATTQAGDAAR CCCCCCCCHHHHHHH | 20.66 | 25307156 | |
175 | Phosphorylation | LQRFRLGTDMSLFAT HHHHCCCCCHHHEEE | 32.87 | - | |
182 | Phosphorylation | TDMSLFATEQLSTGA CCHHHEEEEECCCCC | 19.55 | - | |
220 | Phosphorylation | FTETLDTSPKGYQVP CCCCCCCCCCCCCCC | 25.04 | 25332170 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNG3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNG3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNG3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SNG3_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...