| UniProt ID | OSTC_HUMAN | |
|---|---|---|
| UniProt AC | Q9NRP0 | |
| Protein Name | Oligosaccharyltransferase complex subunit OSTC | |
| Gene Name | OSTC | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 149 | |
| Subcellular Localization |
Endoplasmic reticulum . Membrane Multi-pass membrane protein . |
|
| Protein Description | May act as substrate-specific component of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. May be involved in N-glycosylation of APP (amyloid-beta precursor protein). Can modulate gamma-secretase cleavage of APP by enhancing endoprotelysis of PSEN1.. | |
| Protein Sequence | METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | S-palmitoylation | VPFLVLECPNLKLKK CCEEEEECCCCCCCC | 2.07 | 29575903 | |
| 18 | Ubiquitination | VLECPNLKLKKPPWL EEECCCCCCCCCCCC | 65.97 | 2190698 | |
| 20 | Ubiquitination | ECPNLKLKKPPWLHM ECCCCCCCCCCCCCC | 62.74 | - | |
| 34 | Phosphorylation | MPSAMTVYALVVVSY CCCHHHHHHHHHHHH | 5.76 | - | |
| 40 | Phosphorylation | VYALVVVSYFLITGG HHHHHHHHHHHHHCC | 9.88 | - | |
| 83 | Phosphorylation | AYRVNGQYIMEGLAS EEEECCCHHHHHHHH | 12.02 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OSTC_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OSTC_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OSTC_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of OSTC_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
