UniProt ID | OSTC_HUMAN | |
---|---|---|
UniProt AC | Q9NRP0 | |
Protein Name | Oligosaccharyltransferase complex subunit OSTC | |
Gene Name | OSTC | |
Organism | Homo sapiens (Human). | |
Sequence Length | 149 | |
Subcellular Localization |
Endoplasmic reticulum . Membrane Multi-pass membrane protein . |
|
Protein Description | May act as substrate-specific component of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. May be involved in N-glycosylation of APP (amyloid-beta precursor protein). Can modulate gamma-secretase cleavage of APP by enhancing endoprotelysis of PSEN1.. | |
Protein Sequence | METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | S-palmitoylation | VPFLVLECPNLKLKK CCEEEEECCCCCCCC | 2.07 | 29575903 | |
18 | Ubiquitination | VLECPNLKLKKPPWL EEECCCCCCCCCCCC | 65.97 | 2190698 | |
20 | Ubiquitination | ECPNLKLKKPPWLHM ECCCCCCCCCCCCCC | 62.74 | - | |
34 | Phosphorylation | MPSAMTVYALVVVSY CCCHHHHHHHHHHHH | 5.76 | - | |
40 | Phosphorylation | VYALVVVSYFLITGG HHHHHHHHHHHHHCC | 9.88 | - | |
83 | Phosphorylation | AYRVNGQYIMEGLAS EEEECCCHHHHHHHH | 12.02 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OSTC_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OSTC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OSTC_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of OSTC_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...