| UniProt ID | TPST2_HUMAN | |
|---|---|---|
| UniProt AC | O60704 | |
| Protein Name | Protein-tyrosine sulfotransferase 2 | |
| Gene Name | TPST2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 377 | |
| Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein . |
|
| Protein Description | Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides, using 3'-phosphoadenylyl sulfate (PAPS) as cosubstrate.. | |
| Protein Sequence | MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 40 | Phosphorylation | AVLAGLRSPRGAMRP HHHHCCCCCCCCCCH | 24.80 | 28060719 | |
| 158 | Ubiquitination | PARVLCNKDPFTLKS CCEEEECCCCCCCCC | 66.82 | - | |
| 188 | Phosphorylation | MVRDGRASVHSMITR EEECCCHHHHHHHHC | 20.99 | - | |
| 191 | Phosphorylation | DGRASVHSMITRKVT CCCHHHHHHHHCCEE | 15.10 | - | |
| 194 | Phosphorylation | ASVHSMITRKVTIAG HHHHHHHHCCEEEEC | 18.78 | - | |
| 222 | Phosphorylation | NKAIEVMYAQCMEVG HHHHHHHHHHHHHHC | 9.94 | - | |
| 278 | O-linked_Glycosylation | IGKPGGVSLSKIERS CCCCCCCCHHHHCCC | 30.14 | 55832767 | |
| 285 | O-linked_Glycosylation | SLSKIERSTDQVIKP CHHHHCCCCCCCCCC | 24.44 | 55833279 | |
| 286 | O-linked_Glycosylation | LSKIERSTDQVIKPV HHHHCCCCCCCCCCC | 36.35 | 55833285 | |
| 291 | Ubiquitination | RSTDQVIKPVNLEAL CCCCCCCCCCCHHHH | 44.02 | - | |
| 343 | N-linked_Glycosylation | NPDPFVINNTQRVLK CCCCCEECCCHHCCC | 39.95 | UniProtKB CARBOHYD | |
| 355 | O-linked_Glycosylation | VLKGDYKTPANLKGY CCCCCCCCCCCCCCE | 22.77 | OGP | |
| 368 | N-linked_Glycosylation | GYFQVNQNSTSSHLG CEEEECCCCCCCCCC | 41.89 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPST2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPST2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPST2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TPST2_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
