| UniProt ID | FOXA3_HUMAN | |
|---|---|---|
| UniProt AC | P55318 | |
| Protein Name | Hepatocyte nuclear factor 3-gamma | |
| Gene Name | FOXA3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 350 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites (By similarity). Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis; binds to and activates transcription from the G6PC promoter. Binds to the CYP3A4 promoter and activates its transcription in cooperation with CEBPA. Binds to the CYP3A7 promoter together with members of the CTF/NF-I family. Involved in regulation of neuronal-specific transcription. May be involved in regulation of spermatogenesis.. | |
| Protein Sequence | MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 109 | Phosphorylation | GKEMPKGYRRPLAHA CCCCCCCCCCCCCCC | 15.02 | 22817900 | |
| 120 | Phosphorylation | LAHAKPPYSYISLIT CCCCCCCCCHHHHHH | 23.72 | 27251275 | |
| 121 | Phosphorylation | AHAKPPYSYISLITM CCCCCCCCHHHHHHH | 23.05 | 27251275 | |
| 122 | Phosphorylation | HAKPPYSYISLITMA CCCCCCCHHHHHHHH | 6.67 | 27251275 | |
| 124 | Phosphorylation | KPPYSYISLITMAIQ CCCCCHHHHHHHHHH | 12.89 | 27251275 | |
| 127 | Phosphorylation | YSYISLITMAIQQAP CCHHHHHHHHHHHCC | 13.07 | 27251275 | |
| 139 | Phosphorylation | QAPGKMLTLSEIYQW HCCCCEEEHHHHHHH | 25.41 | 27251275 | |
| 141 | Phosphorylation | PGKMLTLSEIYQWIM CCCEEEHHHHHHHHH | 19.40 | 27251275 | |
| 144 | Phosphorylation | MLTLSEIYQWIMDLF EEEHHHHHHHHHHHH | 8.17 | 27251275 | |
| 153 | Phosphorylation | WIMDLFPYYRENQQR HHHHHHHHHHHHHHH | 14.07 | 27251275 | |
| 154 | Phosphorylation | IMDLFPYYRENQQRW HHHHHHHHHHHHHHH | 16.22 | 27251275 | |
| 170 | Phosphorylation | NSIRHSLSFNDCFVK HHHHHHCCCCCEEEE | 25.64 | 23312004 | |
| 181 | Phosphorylation | CFVKVARSPDKPGKG EEEEEECCCCCCCCC | 27.93 | 30576142 | |
| 206 | Phosphorylation | NMFENGCYLRRQKRF CCCCCCCCCHHCCCE | 12.49 | - | |
| 343 | Phosphorylation | VYYQGLYSRSLLNAS CEEEEEHHHHHHCCC | 22.04 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FOXA3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FOXA3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FOXA3_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...