UniProt ID | PPARA_HUMAN | |
---|---|---|
UniProt AC | Q07869 | |
Protein Name | Peroxisome proliferator-activated receptor alpha | |
Gene Name | PPARA | |
Organism | Homo sapiens (Human). | |
Sequence Length | 468 | |
Subcellular Localization | Nucleus. | |
Protein Description | Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (16:0/18:1-GPC). Activated by oleylethanolamide, a naturally occurring lipid that regulates satiety. Receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the ACOX1 and P450 genes. Transactivation activity requires heterodimerization with RXRA and is antagonized by NR2C2. May be required for the propagation of clock information to metabolic pathways regulated by PER2.. | |
Protein Sequence | MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MVDTESPLCPLSP --CCCCCCCCCCCCC | 25.84 | 18079279 | |
12 | Phosphorylation | ESPLCPLSPLEAGDL CCCCCCCCCCCCCCC | 16.75 | 22817900 | |
21 | Phosphorylation | LEAGDLESPLSEEFL CCCCCCCCCCCHHHH | 38.14 | 22817900 | |
38 | Phosphorylation | MGNIQEISQSIGEDS CCCHHHHHHHHCCCC | 19.68 | 24275569 | |
45 | Phosphorylation | SQSIGEDSSGSFGFT HHHHCCCCCCCCCCE | 32.09 | 24275569 | |
163 | Phosphorylation | CRFHKCLSVGMSHNA CCHHHHHHHCCCHHH | 26.54 | 22210691 | |
179 | Phosphorylation | RFGRMPRSEKAKLKA HCCCCCHHHHHHHHH | 37.26 | 22817900 | |
185 | Sumoylation | RSEKAKLKAEILTCE HHHHHHHHHEEEECC | 43.18 | - | |
185 | Sumoylation | RSEKAKLKAEILTCE HHHHHHHHHEEEECC | 43.18 | - | |
230 | Phosphorylation | VKARVILSGKASNNP CEEEEEECCCCCCCC | 27.42 | 22817900 | |
280 | Phosphorylation | FHCCQCTSVETVTEL EEECCCCCCCCHHHH | 26.11 | - | |
311 | Phosphorylation | DQVTLLKYGVYEAIF CHHHHHHHHHHHHHH | 16.28 | 23403867 | |
314 | Phosphorylation | TLLKYGVYEAIFAML HHHHHHHHHHHHHHH | 8.69 | 23403867 | |
323 | Phosphorylation | AIFAMLSSVMNKDGM HHHHHHHHHHCCCCC | 22.79 | 23403867 | |
340 | Phosphorylation | AYGNGFITREFLKSL EECCCCHHHHHHHHC | 23.14 | 23403867 | |
358 | Sumoylation | FCDIMEPKFDFAMKF CCCCCCCCCCHHHHC | 44.23 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
12 | S | Phosphorylation | Kinase | MAPK-FAMILY | - | GPS |
12 | S | Phosphorylation | Kinase | MAPK_GROUP | - | PhosphoELM |
21 | S | Phosphorylation | Kinase | MAPK-FAMILY | - | GPS |
21 | S | Phosphorylation | Kinase | MAPK_GROUP | - | PhosphoELM |
179 | S | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
179 | S | Phosphorylation | Kinase | PRKCB | P05771-2 | GPS |
230 | S | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
230 | S | Phosphorylation | Kinase | PRKCB | P05771-2 | GPS |
280 | S | Phosphorylation | Kinase | GSK3A | P49840 | PSP |
280 | S | Phosphorylation | Kinase | GSK3A | P18265 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPARA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPARA_HUMAN !! |
loading...