UniProt ID | FABPL_HUMAN | |
---|---|---|
UniProt AC | P07148 | |
Protein Name | Fatty acid-binding protein, liver | |
Gene Name | FABP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 127 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes. [PubMed: 25732850 Binds cholesterol] | |
Protein Sequence | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MSFSGKYQ -------CCCCCCCC | 9.12 | 3838309 | |
11 | Phosphorylation | SGKYQLQSQENFEAF CCCCCCCCHHHHHHH | 48.32 | 20166139 | |
31 | Succinylation | LPEELIQKGKDIKGV CCHHHHHCCCCCCCH | 62.02 | - | |
31 | Succinylation | LPEELIQKGKDIKGV CCHHHHHCCCCCCCH | 62.02 | - | |
33 | Acetylation | EELIQKGKDIKGVSE HHHHHCCCCCCCHHH | 64.41 | 20167786 | |
36 | Succinylation | IQKGKDIKGVSEIVQ HHCCCCCCCHHHHHH | 64.49 | - | |
36 | Succinylation | IQKGKDIKGVSEIVQ HHCCCCCCCHHHHHH | 64.49 | - | |
39 | Phosphorylation | GKDIKGVSEIVQNGK CCCCCCHHHHHHCCC | 30.21 | - | |
46 | Acetylation | SEIVQNGKHFKFTIT HHHHHCCCEEEEEEE | 54.11 | 20167786 | |
46 | Succinylation | SEIVQNGKHFKFTIT HHHHHCCCEEEEEEE | 54.11 | - | |
46 | Succinylation | SEIVQNGKHFKFTIT HHHHHCCCEEEEEEE | 54.11 | - | |
49 | Acetylation | VQNGKHFKFTITAGS HHCCCEEEEEEECCC | 41.12 | 27178108 | |
51 | Phosphorylation | NGKHFKFTITAGSKV CCCEEEEEEECCCEE | 20.29 | 28857561 | |
53 | Phosphorylation | KHFKFTITAGSKVIQ CEEEEEEECCCEEEC | 23.16 | 20166139 | |
56 | Phosphorylation | KFTITAGSKVIQNEF EEEEECCCEEECCEE | 22.68 | 28857561 | |
57 | Succinylation | FTITAGSKVIQNEFT EEEECCCEEECCEEE | 42.30 | - | |
57 | Succinylation | FTITAGSKVIQNEFT EEEECCCEEECCEEE | 42.30 | - | |
64 | Phosphorylation | KVIQNEFTVGEECEL EEECCEEECCCEEEE | 22.79 | 28857561 | |
78 | Succinylation | LETMTGEKVKTVVQL EEECCCCEEEEEEEE | 50.83 | - | |
78 | Succinylation | LETMTGEKVKTVVQL EEECCCCEEEEEEEE | 50.83 | - | |
81 | Phosphorylation | MTGEKVKTVVQLEGD CCCCEEEEEEEEECC | 28.97 | 22798277 | |
90 | Succinylation | VQLEGDNKLVTTFKN EEEECCCCEEEEECC | 49.42 | - | |
90 | Succinylation | VQLEGDNKLVTTFKN EEEECCCCEEEEECC | 49.42 | - | |
100 | Phosphorylation | TTFKNIKSVTELNGD EEECCCCCHHEECCC | 30.40 | 28258704 | |
121 | Succinylation | TLGDIVFKRISKRI- CHHHHHHHHHHHCC- | 37.62 | - | |
121 | Acetylation | TLGDIVFKRISKRI- CHHHHHHHHHHHCC- | 37.62 | 156649 | |
121 | Succinylation | TLGDIVFKRISKRI- CHHHHHHHHHHHCC- | 37.62 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FABPL_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FABPL_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FABPL_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FLNA_HUMAN | FLNA | physical | 25416956 | |
GNA1_HUMAN | GNPNAT1 | physical | 28514442 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB02659 | Cholic Acid |
loading...