| UniProt ID | SIA4B_HUMAN | |
|---|---|---|
| UniProt AC | Q16842 | |
| Protein Name | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 | |
| Gene Name | ST3GAL2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 350 | |
| Subcellular Localization |
Golgi apparatus, Golgi stack membrane Single-pass type II membrane protein. Secreted. Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.. |
|
| Protein Description | Responsible for the synthesis of the sequence NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- found in terminal carbohydrate groups of certain glycoproteins, oligosaccharides and glycolipids. SIAT4A and SIAT4B sialylate the same acceptor substrates but exhibit different Km values.. | |
| Protein Sequence | MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | S-palmitoylation | -----MKCSLRVWFL -----CCCHHHHHHH | 4.47 | 28698248 | |
| 33 | O-linked_Glycosylation | YSHHSMATLPYLDSG HCCCCCCCCCCCCCC | 21.44 | OGP | |
| 61 | Phosphorylation | YAGLQRLSKERLSGK CHHHHHHHHHHHCCC | 34.36 | 23403867 | |
| 92 | N-linked_Glycosylation | FDSHFDGNISPVWTR HHHCCCCCCCCCEEC | 33.15 | UniProtKB CARBOHYD | |
| 184 | O-linked_Glycosylation | MRMNQAPTVGFEQDV EECCCCCCCCCCCCC | 35.96 | OGP | |
| 211 | N-linked_Glycosylation | SAKNLPANVSFVLVP HHCCCCCCEEEEEEE | 28.20 | 25916169 | |
| 240 | Phosphorylation | TGQIRFTYAPVKSFL CCCCEEEEECHHHHE | 13.24 | - | |
| 245 | Phosphorylation | FTYAPVKSFLRVDKE EEEECHHHHEEECHH | 29.73 | 24719451 | |
| 264 | Phosphorylation | YNPAFFKYIHDRWTE ECHHHHHHHHHHHHH | 9.79 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIA4B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIA4B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIA4B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FKB14_HUMAN | FKBP14 | physical | 28514442 | |
| ASPH2_HUMAN | ASPHD2 | physical | 28514442 | |
| CALX_HUMAN | CANX | physical | 28514442 | |
| GRP78_HUMAN | HSPA5 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
