UniProt ID | ASPH2_HUMAN | |
---|---|---|
UniProt AC | Q6ICH7 | |
Protein Name | Aspartate beta-hydroxylase domain-containing protein 2 | |
Gene Name | ASPHD2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 369 | |
Subcellular Localization |
Membrane Single-pass type II membrane protein . |
|
Protein Description | May function as 2-oxoglutarate-dependent dioxygenase.. | |
Protein Sequence | MVWAPLGPPRTDCLTLLHTPSKDSPKMSLEWLVAWSWSLDGLRDCIATGIQSVRDCDTTAVITVACLLVLFVWYCYHVGREQPRPYVSVNSLMQAADANGLQNGYVYCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYLNSRPSIQKPEVFFLPDLPTTPYFSRDAQKHDVEVLERNFQTILCEFETLYKAFSNCSLPQGWKMNSTPSGEWFTFYLVNQGVCVPRNCRKCPRTYRLLGSLRTCIGNNVFGNACISVLSPGTVITEHYGPTNIRIRCHLGLKTPNGCELVVGGEPQCWAEGRCLLFDDSFLHAAFHEGSAEDGPRVVFMVDLWHPNVAAAERQALDFIFAPGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | APLGPPRTDCLTLLH CCCCCCCCCEEEEEC | 36.52 | 30576142 | |
15 | Phosphorylation | PPRTDCLTLLHTPSK CCCCCEEEEECCCCC | 33.34 | 30576142 | |
19 | Phosphorylation | DCLTLLHTPSKDSPK CEEEEECCCCCCCCC | 29.27 | 30576142 | |
86 | Phosphorylation | GREQPRPYVSVNSLM CCCCCCCCEEHHHHH | 13.46 | - | |
105 | Phosphorylation | ANGLQNGYVYCQSPE HCCCCCCEEEECCCC | 8.87 | - | |
107 | Phosphorylation | GLQNGYVYCQSPECV CCCCCEEEECCCCEE | 4.01 | - | |
135 | Methylation | HNLQEYAKRYSWSGM HHHHHHHHHCCCCCC | 51.47 | - | |
175 | Phosphorylation | FFLPDLPTTPYFSRD EECCCCCCCCCCCCC | 47.93 | 26074081 | |
176 | Phosphorylation | FLPDLPTTPYFSRDA ECCCCCCCCCCCCCH | 17.66 | 26074081 | |
178 | Phosphorylation | PDLPTTPYFSRDAQK CCCCCCCCCCCCHHH | 16.46 | 26074081 | |
185 | Ubiquitination | YFSRDAQKHDVEVLE CCCCCHHHCCHHHHH | 43.42 | - | |
211 | N-linked_Glycosylation | TLYKAFSNCSLPQGW HHHHHHCCCCCCCCC | 16.97 | UniProtKB CARBOHYD | |
256 | Phosphorylation | RTYRLLGSLRTCIGN CHHHHHHHHHHHHCC | 18.04 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ASPH2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ASPH2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ASPH2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ASPH2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...