AKIP_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AKIP_HUMAN
• UniProt AC: Q9NWT8
• Protein Name: Aurora kinase A-interacting protein
• Gene Name: AURKAIP1
• Organism: Homo sapiens (Human).
• Sequence Length: 199
• Subcellular Localization: Mitochondrion . Nucleus .
• Protein Description: May act as a negative regulator of Aurora-A kinase, by down-regulation through proteasome-dependent degradation..
• Protein Sequence: MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAASLPRKGAQLELEEMLVPRKMSVSPLESWLTARCFLPRLDTGTAGTVAPPQSYQCPPSQIGEGAEQGDEGVADAPQIQCKNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLRGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MLLGRLTSQLLRAV -CCHHHHHHHHHHHC	17.05	26074081
8	Phosphorylation	MLLGRLTSQLLRAVP CCHHHHHHHHHHHCC	24.35	26074081
50	Phosphorylation	AGPGRAASLPRKGAQ CCCCCCCCCCCCCCC	37.61	24719451
54	Ubiquitination	RAASLPRKGAQLELE CCCCCCCCCCCEEHH	57.57	-
70	Phosphorylation	MLVPRKMSVSPLESW HHCCCCCCCCHHHHH	23.60	22817900
183	Ubiquitination	IWLKAGLKEAPEGWQ HHHHHCCCCCCCCCC	51.41	29967540
191	Phosphorylation	EAPEGWQTPKIYLRG CCCCCCCCCCEEECC	21.75	110759247
193	Ubiquitination	PEGWQTPKIYLRGK- CCCCCCCCEEECCC-	47.58	21890473
222	Ubiquitination	------------------------------ ------------------------------		21890473

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
70	S	Phosphorylation	Kinase	AURA	O14965	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AKIP_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AKIP_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CP131_HUMAN	CEP131	physical	17452972
AURKA_HUMAN	AURKA	physical	17452972
FAM9B_HUMAN	FAM9B	physical	25416956
MMAD_HUMAN	MMADHC	physical	28514442
NRDC_HUMAN	NRD1	physical	28514442
NOA1_HUMAN	NOA1	physical	28514442
WDR83_HUMAN	WDR83	physical	28514442
STRBP_HUMAN	STRBP	physical	28514442
NSUN4_HUMAN	NSUN4	physical	28514442
RT18C_HUMAN	MRPS18C	physical	28514442
DCAF1_HUMAN	VPRBP	physical	28514442
UBE2O_HUMAN	UBE2O	physical	28514442
RT11_HUMAN	MRPS11	physical	28514442
IPO7_HUMAN	IPO7	physical	28514442
PTCD3_HUMAN	PTCD3	physical	28514442
NP1L1_HUMAN	NAP1L1	physical	28514442
RT09_HUMAN	MRPS9	physical	28514442
ZFP91_HUMAN	ZFP91	physical	28514442
RT35_HUMAN	MRPS35	physical	28514442
RT05_HUMAN	MRPS5	physical	28514442
FNTB_HUMAN	FNTB	physical	28514442
MRS2_HUMAN	MRS2	physical	28514442
FBX11_HUMAN	FBXO11	physical	28514442
RT31_HUMAN	MRPS31	physical	28514442
DNLZ_HUMAN	DNLZ	physical	28514442
RT29_HUMAN	DAP3	physical	28514442
RT33_HUMAN	MRPS33	physical	28514442
RT24_HUMAN	MRPS24	physical	28514442
RT07_HUMAN	MRPS7	physical	28514442
RT10_HUMAN	MRPS10	physical	28514442
CSK21_HUMAN	CSNK2A1	physical	28514442
RT18B_HUMAN	MRPS18B	physical	28514442
HNRPR_HUMAN	HNRNPR	physical	28514442
RT21_HUMAN	MRPS21	physical	28514442
RM40_HUMAN	MRPL40	physical	28514442
RT02_HUMAN	MRPS2	physical	28514442
RT27_HUMAN	MRPS27	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.