UniProt ID | DNLZ_HUMAN | |
---|---|---|
UniProt AC | Q5SXM8 | |
Protein Name | DNL-type zinc finger protein | |
Gene Name | DNLZ | |
Organism | Homo sapiens (Human). | |
Sequence Length | 178 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | May function as a co-chaperone towards HSPA9/mortalin which, by itself, is prone to self-aggregation.. | |
Protein Sequence | MLRTALRGAPRLLSRVQPRAPCLRRLWGRGARPEVAGRRRAWAWGWRRSSSEQGPGPAAALGRVEAAHYQLVYTCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGEDEGPPSPGKTEPS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MLRTALRGAPR ----CHHHHHCCHHH | 26.53 | - | |
14 | Phosphorylation | RGAPRLLSRVQPRAP CCHHHHHHHHCCCCH | 34.69 | - | |
49 | Phosphorylation | WAWGWRRSSSEQGPG CHHHCCCCCCCCCCC | 29.64 | 28348404 | |
51 | Phosphorylation | WGWRRSSSEQGPGPA HHCCCCCCCCCCCHH | 34.87 | - | |
156 | Phosphorylation | LEAAGAPTSTAAPEA HHHCCCCCCCCCCCC | 37.87 | 30108239 | |
157 | Phosphorylation | EAAGAPTSTAAPEAG HHCCCCCCCCCCCCC | 18.26 | 30108239 | |
158 | Phosphorylation | AAGAPTSTAAPEAGE HCCCCCCCCCCCCCC | 29.35 | 30108239 | |
171 | Phosphorylation | GEDEGPPSPGKTEPS CCCCCCCCCCCCCCC | 49.79 | 30278072 | |
175 | Phosphorylation | GPPSPGKTEPS---- CCCCCCCCCCC---- | 60.07 | 29496963 | |
178 | Phosphorylation | SPGKTEPS------- CCCCCCCC------- | 46.77 | 30108239 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DNLZ_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DNLZ_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DNLZ_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DNLZ_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...