PSB5_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PSB5_MOUSE
• UniProt AC: O55234
• Protein Name: Proteasome subunit beta type-5
• Gene Name: Psmb5
• Organism: Mus musculus (Mouse).
• Sequence Length: 264
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Within the 20S core complex, PSMB5 displays a chymotrypsin-like activity..
• Protein Sequence: MALASVLQRPMPVNQHGFFGLGGGADLLDLGPGSPGDGLSLAAPSWGVPEEPRIEMLHGTTTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYSSVSVP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
89	Phosphorylation	GAYIASQTVKKVIEI HHHHHCHHHHHHHHC	31.62	25521595
91	Ubiquitination	YIASQTVKKVIEINP HHHCHHHHHHHHCCH	44.72	22790023
92	Ubiquitination	IASQTVKKVIEINPY HHCHHHHHHHHCCHH	44.07	-
103	Phosphorylation	INPYLLGTMAGGAAD CCHHHHCCCCCCHHC	12.10	18579562
111	S-nitrosocysteine	MAGGAADCSFWERLL CCCCHHCCHHHHHHH	2.87	-
111	S-nitrosylation	MAGGAADCSFWERLL CCCCHHCCHHHHHHH	2.87	21278135
161	S-nitrosylation	LSMGTMICGWDKRGP CCCCCEECCCCCCCC	2.91	21278135
161	S-nitrosocysteine	LSMGTMICGWDKRGP CCCCCEECCCCCCCC	2.91	-
171	Phosphorylation	DKRGPGLYYVDSEGN CCCCCCEEEECCCCC	13.83	22817900
189	Phosphorylation	GTAFSVGSGSVYAYG EEEEEECCCEEEEEE	26.24	28285833
191	Phosphorylation	AFSVGSGSVYAYGVM EEEECCCEEEEEEEE	17.41	28285833
207	Ubiquitination	RGYSYDLKVEEAYDL CCCCEEEEHHHHHHH	44.71	22790023
207	Acetylation	RGYSYDLKVEEAYDL CCCCEEEEHHHHHHH	44.71	23954790
220	Phosphorylation	DLARRAIYQATYRDA HHHHHHHHHHHHCCH	7.36	22817900
236	Phosphorylation	SGGAVNLYHVREDGW CCCCEEEEEECCCCE	7.96	22817900
247	Phosphorylation	EDGWIRVSSDNVADL CCCEEEECCCCCCCC	23.33	29899451
248	Phosphorylation	DGWIRVSSDNVADLH CCEEEECCCCCCCCC	30.28	20415495
257	Acetylation	NVADLHDKYSSVSVP CCCCCCHHHCCCCCC	35.96	23954790

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PSB5_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PSB5_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PSB5_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CRY1_HUMAN	CRY1	physical	26496610
DMD_HUMAN	DMD	physical	26496610
KAPCA_HUMAN	PRKACA	physical	26496610
TRY3_HUMAN	PRSS3	physical	26496610
PSA1_HUMAN	PSMA1	physical	26496610
PSA2_HUMAN	PSMA2	physical	26496610
PSA3_HUMAN	PSMA3	physical	26496610
PSA4_HUMAN	PSMA4	physical	26496610
PSA5_HUMAN	PSMA5	physical	26496610
PSA6_HUMAN	PSMA6	physical	26496610
PSA7_HUMAN	PSMA7	physical	26496610
PSB1_HUMAN	PSMB1	physical	26496610
PSB2_HUMAN	PSMB2	physical	26496610
PSB3_HUMAN	PSMB3	physical	26496610
PSB4_HUMAN	PSMB4	physical	26496610
PSB6_HUMAN	PSMB6	physical	26496610
PSB7_HUMAN	PSMB7	physical	26496610
PRS4_HUMAN	PSMC1	physical	26496610
PRS7_HUMAN	PSMC2	physical	26496610
PRS6A_HUMAN	PSMC3	physical	26496610
PRS6B_HUMAN	PSMC4	physical	26496610
PRS8_HUMAN	PSMC5	physical	26496610
PRS10_HUMAN	PSMC6	physical	26496610
PSMD1_HUMAN	PSMD1	physical	26496610
PSMD2_HUMAN	PSMD2	physical	26496610
PSMD3_HUMAN	PSMD3	physical	26496610
PSMD4_HUMAN	PSMD4	physical	26496610
PSMD7_HUMAN	PSMD7	physical	26496610
PSD11_HUMAN	PSMD11	physical	26496610
PSD12_HUMAN	PSMD12	physical	26496610
PSD13_HUMAN	PSMD13	physical	26496610
PSME1_HUMAN	PSME1	physical	26496610
PSME2_HUMAN	PSME2	physical	26496610
RAC1_HUMAN	RAC1	physical	26496610
UBE3A_HUMAN	UBE3A	physical	26496610
CUL1_HUMAN	CUL1	physical	26496610
TTF2_HUMAN	TTF2	physical	26496610
PSMG1_HUMAN	PSMG1	physical	26496610
B4GT4_HUMAN	B4GALT4	physical	26496610
PSMF1_HUMAN	PSMF1	physical	26496610
BCLF1_HUMAN	BCLAF1	physical	26496610
TOM20_HUMAN	TOMM20	physical	26496610
MOONR_HUMAN	KIAA0753	physical	26496610
PARP2_HUMAN	PARP2	physical	26496610
SCAM3_HUMAN	SCAMP3	physical	26496610
ATP9A_HUMAN	ATP9A	physical	26496610
PSME3_HUMAN	PSME3	physical	26496610
PSDE_HUMAN	PSMD14	physical	26496610
ADRM1_HUMAN	ADRM1	physical	26496610
PSME4_HUMAN	PSME4	physical	26496610
FBX7_HUMAN	FBXO7	physical	26496610
APC5_HUMAN	ANAPC5	physical	26496610
AKIR2_HUMAN	AKIRIN2	physical	26496610
UBFD1_HUMAN	UBFD1	physical	26496610
NCLN_HUMAN	NCLN	physical	26496610
PSMG2_HUMAN	PSMG2	physical	26496610
SHRM3_HUMAN	SHROOM3	physical	26496610
EPG5_HUMAN	EPG5	physical	26496610
EAF6_HUMAN	MEAF6	physical	26496610
YIPF5_HUMAN	YIPF5	physical	26496610
ARI5B_HUMAN	ARID5B	physical	26496610
TIM23_HUMAN	TIMM23	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.